Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7167
Gene name	Triosephosphate isomerase 1
Gene symbol	TPI1
Synonyms (NCBI Gene)	HEL-S-49TIMTPITPID
Chromosome	12
Chromosome location	12p13.31
Summary	This gene encodes an enzyme, consisting of two identical proteins, which catalyzes the isomerization of glyceraldehydes 3-phosphate (G3P) and dihydroxy-acetone phosphate (DHAP) in glycolysis and gluconeogenesis. Mutations in this gene are associated with

Show/Hide all (9)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121964845	G>C	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs121964846	G>A	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs121964847	T>C	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs121964848	G>A	Pathogenic	Non coding transcript variant, coding sequence variant, 5 prime UTR variant, missense variant
rs121964849	A>G	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs121964850	G>T	Pathogenic	Non coding transcript variant, coding sequence variant, stop gained
rs587777440	T>C	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs587777441	->G	Pathogenic	Coding sequence variant, genic upstream transcript variant, frameshift variant, non coding transcript variant, upstream transcript variant
rs1565538350	G>A	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant

546

Show/Hide all (546)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000808	hsa-miR-15a-5p	proteomics analysis	18362358
MIRT000807	hsa-miR-16-5p	proteomics analysis	18362358
MIRT049943	hsa-miR-30a-5p	CLASH	23622248
MIRT047515	hsa-miR-10a-5p	CLASH	23622248
MIRT045713	hsa-miR-125a-5p	CLASH	23622248
MIRT044870	hsa-miR-195-5p	CLASH	23622248
MIRT044651	hsa-miR-320a	CLASH	23622248
MIRT043300	hsa-miR-331-3p	CLASH	23622248
MIRT043300	hsa-miR-331-3p	CLASH	23622248
MIRT041278	hsa-miR-193b-3p	CLASH	23622248
MIRT039754	hsa-miR-615-3p	CLASH	23622248
MIRT036219	hsa-miR-320b	CLASH	23622248
MIRT612207	hsa-miR-4719	HITS-CLIP	23824327
MIRT612206	hsa-miR-578	HITS-CLIP	23824327
MIRT652249	hsa-miR-649	HITS-CLIP	23824327
MIRT612207	hsa-miR-4719	HITS-CLIP	23824327
MIRT652248	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT652247	hsa-miR-26b-3p	HITS-CLIP	23824327
MIRT652246	hsa-miR-2116-5p	HITS-CLIP	23824327
MIRT652245	hsa-miR-22-5p	HITS-CLIP	23824327
MIRT652244	hsa-miR-4677-5p	HITS-CLIP	23824327
MIRT612206	hsa-miR-578	HITS-CLIP	23824327
MIRT612207	hsa-miR-4719	HITS-CLIP	23824327
MIRT612206	hsa-miR-578	HITS-CLIP	23824327
MIRT612207	hsa-miR-4719	HITS-CLIP	23824327
MIRT612206	hsa-miR-578	HITS-CLIP	23824327
MIRT612207	hsa-miR-4719	HITS-CLIP	23824327
MIRT612206	hsa-miR-578	HITS-CLIP	23824327
MIRT612207	hsa-miR-4719	HITS-CLIP	23824327
MIRT612206	hsa-miR-578	HITS-CLIP	23824327
MIRT612207	hsa-miR-4719	HITS-CLIP	23824327
MIRT612206	hsa-miR-578	HITS-CLIP	23824327
MIRT612207	hsa-miR-4719	HITS-CLIP	23824327
MIRT612206	hsa-miR-578	HITS-CLIP	23824327
MIRT612207	hsa-miR-4719	HITS-CLIP	23824327
MIRT612206	hsa-miR-578	HITS-CLIP	23824327
MIRT612207	hsa-miR-4719	HITS-CLIP	23824327
MIRT612206	hsa-miR-578	HITS-CLIP	23824327
MIRT462271	hsa-miR-4476	PAR-CLIP	23592263
MIRT462270	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT462269	hsa-miR-6755-5p	PAR-CLIP	23592263
MIRT462267	hsa-miR-7515	PAR-CLIP	23592263
MIRT462268	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT462266	hsa-miR-3202	PAR-CLIP	23592263
MIRT462265	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT462263	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT462264	hsa-miR-4736	PAR-CLIP	23592263
MIRT462262	hsa-miR-7150	PAR-CLIP	23592263
MIRT462265	hsa-miR-1207-5p	PAR-CLIP	26701625
MIRT462265	hsa-miR-1207-5p	PAR-CLIP	26701625
MIRT462265	hsa-miR-1207-5p	PAR-CLIP	26701625
MIRT462265	hsa-miR-1207-5p	PAR-CLIP	26701625
MIRT462265	hsa-miR-1207-5p	PAR-CLIP	26701625
MIRT462265	hsa-miR-1207-5p	PAR-CLIP	26701625
MIRT462266	hsa-miR-3202	PAR-CLIP	26701625
MIRT462266	hsa-miR-3202	PAR-CLIP	26701625
MIRT462266	hsa-miR-3202	PAR-CLIP	26701625
MIRT462266	hsa-miR-3202	PAR-CLIP	26701625
MIRT462266	hsa-miR-3202	PAR-CLIP	26701625
MIRT462266	hsa-miR-3202	PAR-CLIP	26701625
MIRT462271	hsa-miR-4476	PAR-CLIP	26701625
MIRT462271	hsa-miR-4476	PAR-CLIP	26701625
MIRT462271	hsa-miR-4476	PAR-CLIP	26701625
MIRT462271	hsa-miR-4476	PAR-CLIP	26701625
MIRT462271	hsa-miR-4476	PAR-CLIP	26701625
MIRT462271	hsa-miR-4476	PAR-CLIP	26701625
MIRT462271	hsa-miR-4476	PAR-CLIP	26701625
MIRT462271	hsa-miR-4476	PAR-CLIP	26701625
MIRT462264	hsa-miR-4736	PAR-CLIP	26701625
MIRT462264	hsa-miR-4736	PAR-CLIP	26701625
MIRT462264	hsa-miR-4736	PAR-CLIP	26701625
MIRT462264	hsa-miR-4736	PAR-CLIP	26701625
MIRT462264	hsa-miR-4736	PAR-CLIP	26701625
MIRT462264	hsa-miR-4736	PAR-CLIP	26701625
MIRT462263	hsa-miR-4763-3p	PAR-CLIP	26701625
MIRT462263	hsa-miR-4763-3p	PAR-CLIP	26701625
MIRT462263	hsa-miR-4763-3p	PAR-CLIP	26701625
MIRT462263	hsa-miR-4763-3p	PAR-CLIP	26701625
MIRT462263	hsa-miR-4763-3p	PAR-CLIP	26701625
MIRT462263	hsa-miR-4763-3p	PAR-CLIP	26701625
MIRT462269	hsa-miR-6755-5p	PAR-CLIP	26701625
MIRT462269	hsa-miR-6755-5p	PAR-CLIP	26701625
MIRT462269	hsa-miR-6755-5p	PAR-CLIP	26701625
MIRT462269	hsa-miR-6755-5p	PAR-CLIP	26701625
MIRT462269	hsa-miR-6755-5p	PAR-CLIP	26701625
MIRT462269	hsa-miR-6755-5p	PAR-CLIP	26701625
MIRT462270	hsa-miR-6876-5p	PAR-CLIP	26701625
MIRT462270	hsa-miR-6876-5p	PAR-CLIP	26701625
MIRT462270	hsa-miR-6876-5p	PAR-CLIP	26701625
MIRT462270	hsa-miR-6876-5p	PAR-CLIP	26701625
MIRT462270	hsa-miR-6876-5p	PAR-CLIP	26701625
MIRT462270	hsa-miR-6876-5p	PAR-CLIP	26701625
MIRT462270	hsa-miR-6876-5p	PAR-CLIP	26701625
MIRT462270	hsa-miR-6876-5p	PAR-CLIP	26701625
MIRT462262	hsa-miR-7150	PAR-CLIP	26701625
MIRT462262	hsa-miR-7150	PAR-CLIP	26701625
MIRT462262	hsa-miR-7150	PAR-CLIP	26701625
MIRT462262	hsa-miR-7150	PAR-CLIP	26701625
MIRT462262	hsa-miR-7150	PAR-CLIP	26701625
MIRT462262	hsa-miR-7150	PAR-CLIP	26701625
MIRT462267	hsa-miR-7515	PAR-CLIP	26701625
MIRT462267	hsa-miR-7515	PAR-CLIP	26701625
MIRT462267	hsa-miR-7515	PAR-CLIP	26701625
MIRT462267	hsa-miR-7515	PAR-CLIP	26701625
MIRT462267	hsa-miR-7515	PAR-CLIP	26701625
MIRT462267	hsa-miR-7515	PAR-CLIP	26701625
MIRT462268	hsa-miR-873-5p	PAR-CLIP	26701625
MIRT462268	hsa-miR-873-5p	PAR-CLIP	26701625
MIRT462268	hsa-miR-873-5p	PAR-CLIP	26701625
MIRT462268	hsa-miR-873-5p	PAR-CLIP	26701625
MIRT462268	hsa-miR-873-5p	PAR-CLIP	26701625
MIRT462268	hsa-miR-873-5p	PAR-CLIP	26701625
MIRT612207	hsa-miR-4719	HITS-CLIP	23824327
MIRT612206	hsa-miR-578	HITS-CLIP	23824327
MIRT652249	hsa-miR-649	HITS-CLIP	23824327
MIRT612207	hsa-miR-4719	HITS-CLIP	23824327
MIRT652248	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT652247	hsa-miR-26b-3p	HITS-CLIP	23824327
MIRT652246	hsa-miR-2116-5p	HITS-CLIP	23824327
MIRT652245	hsa-miR-22-5p	HITS-CLIP	23824327
MIRT652244	hsa-miR-4677-5p	HITS-CLIP	23824327
MIRT612206	hsa-miR-578	HITS-CLIP	23824327
MIRT612207	hsa-miR-4719	HITS-CLIP	23824327
MIRT612206	hsa-miR-578	HITS-CLIP	23824327
MIRT612207	hsa-miR-4719	HITS-CLIP	23824327
MIRT612206	hsa-miR-578	HITS-CLIP	23824327
MIRT612207	hsa-miR-4719	HITS-CLIP	23824327
MIRT612206	hsa-miR-578	HITS-CLIP	23824327
MIRT612207	hsa-miR-4719	HITS-CLIP	23824327
MIRT612206	hsa-miR-578	HITS-CLIP	23824327
MIRT612207	hsa-miR-4719	HITS-CLIP	23824327
MIRT612206	hsa-miR-578	HITS-CLIP	23824327
MIRT612207	hsa-miR-4719	HITS-CLIP	23824327
MIRT612206	hsa-miR-578	HITS-CLIP	23824327
MIRT612207	hsa-miR-4719	HITS-CLIP	23824327
MIRT612206	hsa-miR-578	HITS-CLIP	23824327
MIRT612207	hsa-miR-4719	HITS-CLIP	23824327
MIRT612206	hsa-miR-578	HITS-CLIP	23824327
MIRT462271	hsa-miR-4476	PAR-CLIP	23592263
MIRT462270	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT462269	hsa-miR-6755-5p	PAR-CLIP	23592263
MIRT462267	hsa-miR-7515	PAR-CLIP	23592263
MIRT462268	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT462266	hsa-miR-3202	PAR-CLIP	23592263
MIRT462265	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT462263	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT462264	hsa-miR-4736	PAR-CLIP	23592263
MIRT462262	hsa-miR-7150	PAR-CLIP	23592263
MIRT1449306	hsa-miR-1193	CLIP-seq
MIRT1449307	hsa-miR-1237	CLIP-seq
MIRT1449308	hsa-miR-1245b-3p	CLIP-seq
MIRT1449309	hsa-miR-1255b	CLIP-seq
MIRT1449310	hsa-miR-1285	CLIP-seq
MIRT1449311	hsa-miR-1293	CLIP-seq
MIRT1449312	hsa-miR-1587	CLIP-seq
MIRT1449313	hsa-miR-1825	CLIP-seq
MIRT1449314	hsa-miR-1909	CLIP-seq
MIRT1449315	hsa-miR-199a-5p	CLIP-seq
MIRT1449316	hsa-miR-199b-5p	CLIP-seq
MIRT1449317	hsa-miR-2114	CLIP-seq
MIRT1449318	hsa-miR-22	CLIP-seq
MIRT1449319	hsa-miR-2392	CLIP-seq
MIRT1449320	hsa-miR-23a	CLIP-seq
MIRT1449321	hsa-miR-23b	CLIP-seq
MIRT1449322	hsa-miR-23c	CLIP-seq
MIRT1449323	hsa-miR-3126-3p	CLIP-seq
MIRT1449324	hsa-miR-3153	CLIP-seq
MIRT1449325	hsa-miR-3154	CLIP-seq
MIRT1449326	hsa-miR-3157-5p	CLIP-seq
MIRT1449327	hsa-miR-3166	CLIP-seq
MIRT1449328	hsa-miR-3184	CLIP-seq
MIRT1449329	hsa-miR-3187-5p	CLIP-seq
MIRT1449330	hsa-miR-3605-5p	CLIP-seq
MIRT1449331	hsa-miR-3613-3p	CLIP-seq
MIRT1449332	hsa-miR-3653	CLIP-seq
MIRT1449333	hsa-miR-3714	CLIP-seq
MIRT1449334	hsa-miR-371b-5p	CLIP-seq
MIRT1449335	hsa-miR-378g	CLIP-seq
MIRT1449336	hsa-miR-423-5p	CLIP-seq
MIRT1449337	hsa-miR-425	CLIP-seq
MIRT1449338	hsa-miR-4281	CLIP-seq
MIRT1449339	hsa-miR-4292	CLIP-seq
MIRT1449340	hsa-miR-4297	CLIP-seq
MIRT1449341	hsa-miR-4303	CLIP-seq
MIRT1449342	hsa-miR-4308	CLIP-seq
MIRT1449343	hsa-miR-4314	CLIP-seq
MIRT1449344	hsa-miR-4426	CLIP-seq
MIRT1449345	hsa-miR-4428	CLIP-seq
MIRT1449346	hsa-miR-4434	CLIP-seq
MIRT1449347	hsa-miR-4483	CLIP-seq
MIRT1449348	hsa-miR-4486	CLIP-seq
MIRT1449349	hsa-miR-4492	CLIP-seq
MIRT1449350	hsa-miR-4493	CLIP-seq
MIRT1449351	hsa-miR-4498	CLIP-seq
MIRT1449352	hsa-miR-4516	CLIP-seq
MIRT1449353	hsa-miR-4528	CLIP-seq
MIRT1449354	hsa-miR-4531	CLIP-seq
MIRT1449355	hsa-miR-4540	CLIP-seq
MIRT1449356	hsa-miR-4647	CLIP-seq
MIRT1449357	hsa-miR-4649-3p	CLIP-seq
MIRT1449358	hsa-miR-4656	CLIP-seq
MIRT1449359	hsa-miR-4662b	CLIP-seq
MIRT1449360	hsa-miR-4672	CLIP-seq
MIRT1449361	hsa-miR-4675	CLIP-seq
MIRT1449362	hsa-miR-4691-3p	CLIP-seq
MIRT1449363	hsa-miR-4699-5p	CLIP-seq
MIRT1449364	hsa-miR-4717-3p	CLIP-seq
MIRT1449365	hsa-miR-4741	CLIP-seq
MIRT1449366	hsa-miR-4757-5p	CLIP-seq
MIRT1449367	hsa-miR-4786-3p	CLIP-seq
MIRT1449368	hsa-miR-5095	CLIP-seq
MIRT1449369	hsa-miR-612	CLIP-seq
MIRT1449370	hsa-miR-642a	CLIP-seq
MIRT1449371	hsa-miR-762	CLIP-seq
MIRT1449372	hsa-miR-876-3p	CLIP-seq
MIRT1449373	hsa-miR-885-5p	CLIP-seq
MIRT1449374	hsa-miR-935	CLIP-seq
MIRT1449335	hsa-miR-378g	CLIP-seq
MIRT1449346	hsa-miR-4434	CLIP-seq
MIRT1449352	hsa-miR-4516	CLIP-seq
MIRT1449312	hsa-miR-1587	CLIP-seq
MIRT1449317	hsa-miR-2114	CLIP-seq
MIRT1449335	hsa-miR-378g	CLIP-seq
MIRT1449349	hsa-miR-4492	CLIP-seq
MIRT1449351	hsa-miR-4498	CLIP-seq
MIRT1449355	hsa-miR-4540	CLIP-seq
MIRT1449358	hsa-miR-4656	CLIP-seq
MIRT1449361	hsa-miR-4675	CLIP-seq
MIRT1449365	hsa-miR-4741	CLIP-seq
MIRT1449371	hsa-miR-762	CLIP-seq
MIRT1449310	hsa-miR-1285	CLIP-seq
MIRT1449312	hsa-miR-1587	CLIP-seq
MIRT1449314	hsa-miR-1909	CLIP-seq
MIRT1449317	hsa-miR-2114	CLIP-seq
MIRT1449324	hsa-miR-3153	CLIP-seq
MIRT1449329	hsa-miR-3187-5p	CLIP-seq
MIRT1449335	hsa-miR-378g	CLIP-seq
MIRT1449339	hsa-miR-4292	CLIP-seq
MIRT1449342	hsa-miR-4308	CLIP-seq
MIRT1449343	hsa-miR-4314	CLIP-seq
MIRT1449348	hsa-miR-4486	CLIP-seq
MIRT1449349	hsa-miR-4492	CLIP-seq
MIRT1449351	hsa-miR-4498	CLIP-seq
MIRT1449355	hsa-miR-4540	CLIP-seq
MIRT1449358	hsa-miR-4656	CLIP-seq
MIRT1449361	hsa-miR-4675	CLIP-seq
MIRT1449365	hsa-miR-4741	CLIP-seq
MIRT1449369	hsa-miR-612	CLIP-seq
MIRT1449371	hsa-miR-762	CLIP-seq
MIRT1449374	hsa-miR-935	CLIP-seq
MIRT1449310	hsa-miR-1285	CLIP-seq
MIRT1449312	hsa-miR-1587	CLIP-seq
MIRT1449314	hsa-miR-1909	CLIP-seq
MIRT1449317	hsa-miR-2114	CLIP-seq
MIRT1449324	hsa-miR-3153	CLIP-seq
MIRT1449329	hsa-miR-3187-5p	CLIP-seq
MIRT1449335	hsa-miR-378g	CLIP-seq
MIRT1449339	hsa-miR-4292	CLIP-seq
MIRT1449342	hsa-miR-4308	CLIP-seq
MIRT1449343	hsa-miR-4314	CLIP-seq
MIRT1449348	hsa-miR-4486	CLIP-seq
MIRT1449349	hsa-miR-4492	CLIP-seq
MIRT1449351	hsa-miR-4498	CLIP-seq
MIRT1449355	hsa-miR-4540	CLIP-seq
MIRT1449358	hsa-miR-4656	CLIP-seq
MIRT1449361	hsa-miR-4675	CLIP-seq
MIRT1449365	hsa-miR-4741	CLIP-seq
MIRT1449369	hsa-miR-612	CLIP-seq
MIRT1449371	hsa-miR-762	CLIP-seq
MIRT1449374	hsa-miR-935	CLIP-seq
MIRT1449335	hsa-miR-378g	CLIP-seq
MIRT1449335	hsa-miR-378g	CLIP-seq
MIRT2134388	hsa-miR-1224-3p	CLIP-seq
MIRT2134389	hsa-miR-1236	CLIP-seq
MIRT1449307	hsa-miR-1237	CLIP-seq
MIRT2134390	hsa-miR-1260	CLIP-seq
MIRT2134391	hsa-miR-1260b	CLIP-seq
MIRT2134392	hsa-miR-1280	CLIP-seq
MIRT1449310	hsa-miR-1285	CLIP-seq
MIRT1449311	hsa-miR-1293	CLIP-seq
MIRT1449312	hsa-miR-1587	CLIP-seq
MIRT1449314	hsa-miR-1909	CLIP-seq
MIRT1449317	hsa-miR-2114	CLIP-seq
MIRT1449320	hsa-miR-23a	CLIP-seq
MIRT1449321	hsa-miR-23b	CLIP-seq
MIRT1449322	hsa-miR-23c	CLIP-seq
MIRT1449324	hsa-miR-3153	CLIP-seq
MIRT1449325	hsa-miR-3154	CLIP-seq
MIRT1449326	hsa-miR-3157-5p	CLIP-seq
MIRT1449328	hsa-miR-3184	CLIP-seq
MIRT1449329	hsa-miR-3187-5p	CLIP-seq
MIRT1449332	hsa-miR-3653	CLIP-seq
MIRT2134393	hsa-miR-371-3p	CLIP-seq
MIRT2134394	hsa-miR-371b-3p	CLIP-seq
MIRT1449335	hsa-miR-378g	CLIP-seq
MIRT2134395	hsa-miR-3938	CLIP-seq
MIRT1449336	hsa-miR-423-5p	CLIP-seq
MIRT1449338	hsa-miR-4281	CLIP-seq
MIRT1449339	hsa-miR-4292	CLIP-seq
MIRT1449340	hsa-miR-4297	CLIP-seq
MIRT1449341	hsa-miR-4303	CLIP-seq
MIRT1449342	hsa-miR-4308	CLIP-seq
MIRT1449343	hsa-miR-4314	CLIP-seq
MIRT1449345	hsa-miR-4428	CLIP-seq
MIRT1449346	hsa-miR-4434	CLIP-seq
MIRT1449347	hsa-miR-4483	CLIP-seq
MIRT1449348	hsa-miR-4486	CLIP-seq
MIRT1449349	hsa-miR-4492	CLIP-seq
MIRT1449351	hsa-miR-4498	CLIP-seq
MIRT1449352	hsa-miR-4516	CLIP-seq
MIRT1449353	hsa-miR-4528	CLIP-seq
MIRT1449354	hsa-miR-4531	CLIP-seq
MIRT1449355	hsa-miR-4540	CLIP-seq
MIRT1449357	hsa-miR-4649-3p	CLIP-seq
MIRT1449358	hsa-miR-4656	CLIP-seq
MIRT1449360	hsa-miR-4672	CLIP-seq
MIRT1449361	hsa-miR-4675	CLIP-seq
MIRT1449362	hsa-miR-4691-3p	CLIP-seq
MIRT1449363	hsa-miR-4699-5p	CLIP-seq
MIRT1449364	hsa-miR-4717-3p	CLIP-seq
MIRT1449365	hsa-miR-4741	CLIP-seq
MIRT2134396	hsa-miR-4753-3p	CLIP-seq
MIRT2134397	hsa-miR-4755-3p	CLIP-seq
MIRT1449366	hsa-miR-4757-5p	CLIP-seq
MIRT1449367	hsa-miR-4786-3p	CLIP-seq
MIRT1449368	hsa-miR-5095	CLIP-seq
MIRT2134398	hsa-miR-515-3p	CLIP-seq
MIRT2134399	hsa-miR-519e	CLIP-seq
MIRT2134400	hsa-miR-605	CLIP-seq
MIRT1449369	hsa-miR-612	CLIP-seq
MIRT1449370	hsa-miR-642a	CLIP-seq
MIRT2134401	hsa-miR-665	CLIP-seq
MIRT1449371	hsa-miR-762	CLIP-seq
MIRT1449372	hsa-miR-876-3p	CLIP-seq
MIRT1449373	hsa-miR-885-5p	CLIP-seq
MIRT1449374	hsa-miR-935	CLIP-seq
MIRT2134389	hsa-miR-1236	CLIP-seq
MIRT1449307	hsa-miR-1237	CLIP-seq
MIRT1449308	hsa-miR-1245b-3p	CLIP-seq
MIRT1449309	hsa-miR-1255b	CLIP-seq
MIRT1449311	hsa-miR-1293	CLIP-seq
MIRT1449314	hsa-miR-1909	CLIP-seq
MIRT2355666	hsa-miR-1913	CLIP-seq
MIRT1449320	hsa-miR-23a	CLIP-seq
MIRT1449321	hsa-miR-23b	CLIP-seq
MIRT1449322	hsa-miR-23c	CLIP-seq
MIRT1449324	hsa-miR-3153	CLIP-seq
MIRT1449325	hsa-miR-3154	CLIP-seq
MIRT1449326	hsa-miR-3157-5p	CLIP-seq
MIRT2355667	hsa-miR-3182	CLIP-seq
MIRT1449328	hsa-miR-3184	CLIP-seq
MIRT2355668	hsa-miR-324-3p	CLIP-seq
MIRT1449332	hsa-miR-3653	CLIP-seq
MIRT1449335	hsa-miR-378g	CLIP-seq
MIRT2134395	hsa-miR-3938	CLIP-seq
MIRT1449336	hsa-miR-423-5p	CLIP-seq
MIRT1449337	hsa-miR-425	CLIP-seq
MIRT2355669	hsa-miR-4290	CLIP-seq
MIRT1449340	hsa-miR-4297	CLIP-seq
MIRT1449341	hsa-miR-4303	CLIP-seq
MIRT1449345	hsa-miR-4428	CLIP-seq
MIRT1449346	hsa-miR-4434	CLIP-seq
MIRT1449347	hsa-miR-4483	CLIP-seq
MIRT1449352	hsa-miR-4516	CLIP-seq
MIRT1449357	hsa-miR-4649-3p	CLIP-seq
MIRT1449360	hsa-miR-4672	CLIP-seq
MIRT1449362	hsa-miR-4691-3p	CLIP-seq
MIRT1449363	hsa-miR-4699-5p	CLIP-seq
MIRT1449364	hsa-miR-4717-3p	CLIP-seq
MIRT2355670	hsa-miR-4727-5p	CLIP-seq
MIRT2134396	hsa-miR-4753-3p	CLIP-seq
MIRT1449366	hsa-miR-4757-5p	CLIP-seq
MIRT2355671	hsa-miR-4768-5p	CLIP-seq
MIRT1449367	hsa-miR-4786-3p	CLIP-seq
MIRT1449368	hsa-miR-5095	CLIP-seq
MIRT1449370	hsa-miR-642a	CLIP-seq
MIRT1449372	hsa-miR-876-3p	CLIP-seq
MIRT1449374	hsa-miR-935	CLIP-seq
MIRT1449335	hsa-miR-378g	CLIP-seq
MIRT1449326	hsa-miR-3157-5p	CLIP-seq
MIRT1449345	hsa-miR-4428	CLIP-seq
MIRT1449346	hsa-miR-4434	CLIP-seq
MIRT1449352	hsa-miR-4516	CLIP-seq
MIRT1449362	hsa-miR-4691-3p	CLIP-seq
MIRT1449367	hsa-miR-4786-3p	CLIP-seq
MIRT1449335	hsa-miR-378g	CLIP-seq
MIRT1449335	hsa-miR-378g	CLIP-seq
MIRT1449306	hsa-miR-1193	CLIP-seq
MIRT2134388	hsa-miR-1224-3p	CLIP-seq
MIRT2134389	hsa-miR-1236	CLIP-seq
MIRT1449307	hsa-miR-1237	CLIP-seq
MIRT2134390	hsa-miR-1260	CLIP-seq
MIRT2134391	hsa-miR-1260b	CLIP-seq
MIRT2134392	hsa-miR-1280	CLIP-seq
MIRT1449310	hsa-miR-1285	CLIP-seq
MIRT1449311	hsa-miR-1293	CLIP-seq
MIRT2649227	hsa-miR-1296	CLIP-seq
MIRT1449312	hsa-miR-1587	CLIP-seq
MIRT1449314	hsa-miR-1909	CLIP-seq
MIRT2355666	hsa-miR-1913	CLIP-seq
MIRT1449317	hsa-miR-2114	CLIP-seq
MIRT1449319	hsa-miR-2392	CLIP-seq
MIRT1449320	hsa-miR-23a	CLIP-seq
MIRT1449321	hsa-miR-23b	CLIP-seq
MIRT1449322	hsa-miR-23c	CLIP-seq
MIRT2649228	hsa-miR-3134	CLIP-seq
MIRT2649229	hsa-miR-3135	CLIP-seq
MIRT1449324	hsa-miR-3153	CLIP-seq
MIRT1449325	hsa-miR-3154	CLIP-seq
MIRT1449326	hsa-miR-3157-5p	CLIP-seq
MIRT2355667	hsa-miR-3182	CLIP-seq
MIRT1449328	hsa-miR-3184	CLIP-seq
MIRT1449329	hsa-miR-3187-5p	CLIP-seq
MIRT2355668	hsa-miR-324-3p	CLIP-seq
MIRT1449330	hsa-miR-3605-5p	CLIP-seq
MIRT1449332	hsa-miR-3653	CLIP-seq
MIRT2649230	hsa-miR-3675-5p	CLIP-seq
MIRT2134393	hsa-miR-371-3p	CLIP-seq
MIRT2134394	hsa-miR-371b-3p	CLIP-seq
MIRT1449335	hsa-miR-378g	CLIP-seq
MIRT2134395	hsa-miR-3938	CLIP-seq
MIRT1449336	hsa-miR-423-5p	CLIP-seq
MIRT2355669	hsa-miR-4290	CLIP-seq
MIRT1449339	hsa-miR-4292	CLIP-seq
MIRT1449340	hsa-miR-4297	CLIP-seq
MIRT1449341	hsa-miR-4303	CLIP-seq
MIRT1449342	hsa-miR-4308	CLIP-seq
MIRT1449343	hsa-miR-4314	CLIP-seq
MIRT1449344	hsa-miR-4426	CLIP-seq
MIRT1449345	hsa-miR-4428	CLIP-seq
MIRT1449346	hsa-miR-4434	CLIP-seq
MIRT1449347	hsa-miR-4483	CLIP-seq
MIRT1449348	hsa-miR-4486	CLIP-seq
MIRT1449349	hsa-miR-4492	CLIP-seq
MIRT1449351	hsa-miR-4498	CLIP-seq
MIRT2649231	hsa-miR-4512	CLIP-seq
MIRT1449352	hsa-miR-4516	CLIP-seq
MIRT1449355	hsa-miR-4540	CLIP-seq
MIRT1449356	hsa-miR-4647	CLIP-seq
MIRT1449357	hsa-miR-4649-3p	CLIP-seq
MIRT1449358	hsa-miR-4656	CLIP-seq
MIRT1449359	hsa-miR-4662b	CLIP-seq
MIRT1449360	hsa-miR-4672	CLIP-seq
MIRT1449361	hsa-miR-4675	CLIP-seq
MIRT1449362	hsa-miR-4691-3p	CLIP-seq
MIRT1449363	hsa-miR-4699-5p	CLIP-seq
MIRT1449364	hsa-miR-4717-3p	CLIP-seq
MIRT2355670	hsa-miR-4727-5p	CLIP-seq
MIRT1449365	hsa-miR-4741	CLIP-seq
MIRT2134396	hsa-miR-4753-3p	CLIP-seq
MIRT2134397	hsa-miR-4755-3p	CLIP-seq
MIRT1449366	hsa-miR-4757-5p	CLIP-seq
MIRT2355671	hsa-miR-4768-5p	CLIP-seq
MIRT1449367	hsa-miR-4786-3p	CLIP-seq
MIRT1449368	hsa-miR-5095	CLIP-seq
MIRT2134398	hsa-miR-515-3p	CLIP-seq
MIRT2134399	hsa-miR-519e	CLIP-seq
MIRT2134400	hsa-miR-605	CLIP-seq
MIRT1449369	hsa-miR-612	CLIP-seq
MIRT1449370	hsa-miR-642a	CLIP-seq
MIRT2134401	hsa-miR-665	CLIP-seq
MIRT1449371	hsa-miR-762	CLIP-seq
MIRT1449372	hsa-miR-876-3p	CLIP-seq
MIRT1449373	hsa-miR-885-5p	CLIP-seq
MIRT1449374	hsa-miR-935	CLIP-seq
MIRT1449306	hsa-miR-1193	CLIP-seq
MIRT2134388	hsa-miR-1224-3p	CLIP-seq
MIRT2134389	hsa-miR-1236	CLIP-seq
MIRT1449307	hsa-miR-1237	CLIP-seq
MIRT2134390	hsa-miR-1260	CLIP-seq
MIRT2134391	hsa-miR-1260b	CLIP-seq
MIRT2134392	hsa-miR-1280	CLIP-seq
MIRT1449310	hsa-miR-1285	CLIP-seq
MIRT1449311	hsa-miR-1293	CLIP-seq
MIRT2649227	hsa-miR-1296	CLIP-seq
MIRT1449312	hsa-miR-1587	CLIP-seq
MIRT1449314	hsa-miR-1909	CLIP-seq
MIRT2355666	hsa-miR-1913	CLIP-seq
MIRT1449317	hsa-miR-2114	CLIP-seq
MIRT1449319	hsa-miR-2392	CLIP-seq
MIRT1449320	hsa-miR-23a	CLIP-seq
MIRT1449321	hsa-miR-23b	CLIP-seq
MIRT1449322	hsa-miR-23c	CLIP-seq
MIRT2649228	hsa-miR-3134	CLIP-seq
MIRT2649229	hsa-miR-3135	CLIP-seq
MIRT1449324	hsa-miR-3153	CLIP-seq
MIRT1449325	hsa-miR-3154	CLIP-seq
MIRT1449326	hsa-miR-3157-5p	CLIP-seq
MIRT2355667	hsa-miR-3182	CLIP-seq
MIRT1449328	hsa-miR-3184	CLIP-seq
MIRT1449329	hsa-miR-3187-5p	CLIP-seq
MIRT2355668	hsa-miR-324-3p	CLIP-seq
MIRT1449330	hsa-miR-3605-5p	CLIP-seq
MIRT1449332	hsa-miR-3653	CLIP-seq
MIRT2649230	hsa-miR-3675-5p	CLIP-seq
MIRT2134393	hsa-miR-371-3p	CLIP-seq
MIRT2134394	hsa-miR-371b-3p	CLIP-seq
MIRT1449335	hsa-miR-378g	CLIP-seq
MIRT2134395	hsa-miR-3938	CLIP-seq
MIRT1449336	hsa-miR-423-5p	CLIP-seq
MIRT1449338	hsa-miR-4281	CLIP-seq
MIRT2355669	hsa-miR-4290	CLIP-seq
MIRT1449339	hsa-miR-4292	CLIP-seq
MIRT1449340	hsa-miR-4297	CLIP-seq
MIRT1449341	hsa-miR-4303	CLIP-seq
MIRT1449342	hsa-miR-4308	CLIP-seq
MIRT1449343	hsa-miR-4314	CLIP-seq
MIRT1449344	hsa-miR-4426	CLIP-seq
MIRT1449345	hsa-miR-4428	CLIP-seq
MIRT1449346	hsa-miR-4434	CLIP-seq
MIRT1449347	hsa-miR-4483	CLIP-seq
MIRT1449348	hsa-miR-4486	CLIP-seq
MIRT1449349	hsa-miR-4492	CLIP-seq
MIRT1449351	hsa-miR-4498	CLIP-seq
MIRT2649231	hsa-miR-4512	CLIP-seq
MIRT1449352	hsa-miR-4516	CLIP-seq
MIRT1449353	hsa-miR-4528	CLIP-seq
MIRT1449354	hsa-miR-4531	CLIP-seq
MIRT1449355	hsa-miR-4540	CLIP-seq
MIRT1449356	hsa-miR-4647	CLIP-seq
MIRT1449357	hsa-miR-4649-3p	CLIP-seq
MIRT1449358	hsa-miR-4656	CLIP-seq
MIRT1449359	hsa-miR-4662b	CLIP-seq
MIRT1449360	hsa-miR-4672	CLIP-seq
MIRT1449361	hsa-miR-4675	CLIP-seq
MIRT1449362	hsa-miR-4691-3p	CLIP-seq
MIRT1449363	hsa-miR-4699-5p	CLIP-seq
MIRT1449364	hsa-miR-4717-3p	CLIP-seq
MIRT2355670	hsa-miR-4727-5p	CLIP-seq
MIRT1449365	hsa-miR-4741	CLIP-seq
MIRT2134396	hsa-miR-4753-3p	CLIP-seq
MIRT2134397	hsa-miR-4755-3p	CLIP-seq
MIRT1449366	hsa-miR-4757-5p	CLIP-seq
MIRT2355671	hsa-miR-4768-5p	CLIP-seq
MIRT1449367	hsa-miR-4786-3p	CLIP-seq
MIRT1449368	hsa-miR-5095	CLIP-seq
MIRT2134398	hsa-miR-515-3p	CLIP-seq
MIRT2134399	hsa-miR-519e	CLIP-seq
MIRT2134400	hsa-miR-605	CLIP-seq
MIRT1449369	hsa-miR-612	CLIP-seq
MIRT1449370	hsa-miR-642a	CLIP-seq
MIRT2134401	hsa-miR-665	CLIP-seq
MIRT1449371	hsa-miR-762	CLIP-seq
MIRT1449372	hsa-miR-876-3p	CLIP-seq
MIRT1449373	hsa-miR-885-5p	CLIP-seq
MIRT1449374	hsa-miR-935	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004807	Function	Triose-phosphate isomerase activity	IBA
GO:0004807	Function	Triose-phosphate isomerase activity	IDA	18562316
GO:0004807	Function	Triose-phosphate isomerase activity	IEA
GO:0004807	Function	Triose-phosphate isomerase activity	NAS	2876430
GO:0004807	Function	Triose-phosphate isomerase activity	TAS	2579079
GO:0005515	Function	Protein binding	IPI	20849852, 21044950, 23355646, 32814053
GO:0005615	Component	Extracellular space	HDA	16502470, 22664934, 23580065
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006094	Process	Gluconeogenesis	IBA
GO:0006094	Process	Gluconeogenesis	IEA
GO:0006096	Process	Glycolytic process	IBA
GO:0006096	Process	Glycolytic process	IEA
GO:0008929	Function	Methylglyoxal synthase activity	IEA
GO:0008929	Function	Methylglyoxal synthase activity	ISS
GO:0016829	Function	Lyase activity	IEA
GO:0016853	Function	Isomerase activity	IEA
GO:0019242	Process	Methylglyoxal biosynthetic process	ISS
GO:0019563	Process	Glycerol catabolic process	IBA
GO:0019682	Process	Glyceraldehyde-3-phosphate metabolic process	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	19725078
GO:0042803	Function	Protein homodimerization activity	IDA	18562316
GO:0046166	Process	Glyceraldehyde-3-phosphate biosynthetic process	IBA
GO:0046166	Process	Glyceraldehyde-3-phosphate biosynthetic process	IDA	18562316
GO:0061621	Process	Canonical glycolysis	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

MIM	HGNC	e!Ensembl
190450	12009	ENSG00000111669

P60174

Protein name

Triosephosphate isomerase (TIM) (EC 5.3.1.1) (Methylglyoxal synthase) (EC 4.2.3.3) (Triose-phosphate isomerase)

Protein function

Triosephosphate isomerase is an extremely efficient metabolic enzyme that catalyzes the interconversion between dihydroxyacetone phosphate (DHAP) and D-glyceraldehyde-3-phosphate (G3P) in glycolysis and gluconeogenesis. {ECO:0000269|PubMed:18562

PDB

1HTI , 1KLG , 1KLU , 1WYI , 2IAM , 2IAN , 2JK2 , 2VOM , 4BR1 , 4E41 , 4POC , 4POD , 4UNK , 4UNL , 4ZVJ , 6C2G , 6D43 , 6NLH , 6UP1 , 6UP5 , 6UP8 , 6UPF , 7RDE , 7SX1 , 7T0Q , 7UXB , 7UXV , 9F69 , 9FFC

Family and domains

Pfam

Warning: Undefined array key 281 in /var/www/html/gene_detail.php on line 1100

Accession	ID	Position in sequence	Description	Type
PF00121	TIM	44 → 282	Triosephosphate isomerase	Domain

Sequence

MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKI
AVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAE
GLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQ
QAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPE
FVDIINAKQ

Sequence length

249

Interactions

View interactions

	KEGG		Reactome
	Glycolysis / Gluconeogenesis Fructose and mannose metabolism Inositol phosphate metabolism Metabolic pathways Carbon metabolism Biosynthesis of amino acids		Glycolysis Gluconeogenesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Triosephosphate isomerase deficiency	Pathogenic; Likely pathogenic	rs587777440, rs587777441, rs2138094606, rs121964845, rs121964848, rs121964849, rs121964850	RCV000123389 RCV000123390 RCV002272749 RCV000013284 RCV000013289 RCV000013290 RCV000013291 RCV003990811 View all (3 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (22)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA, HEMOLYTIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA, HEMOLYTIC, CONGENITAL NONSPHEROCYTIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARBOHYDRATE METABOLISM, INBORN ERRORS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISORDER OF CARBOHYDRATE METABOLISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOUTH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROMUSCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TPI1-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIOSE PHOSPHATE ISOMERASE DEFICIENCY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIOSE PHOSPHATE-ISOMERASE DEFICIENCY	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIOSEPHOSPHATE ISOMERASE MANCHESTER	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (154)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Abnormal involuntary movement	Abnormal Involuntary Movement	BEFREE	14743370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	19374891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	10556207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute schizophrenia	Schizophrenia	PSYGENET_DG	22623148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	19955839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	12114434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	27602772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	18752637, 36809524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	19374891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	19374891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	19374891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	19374891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	2876430	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic Congenital	Hemolytic anemia	Pubtator	10556207	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic Congenital Nonspherocytic	Hemolytic anemia	Pubtator	8503454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic	Anemia	BEFREE	12023819, 18458110, 20374271, 27031109, 29720471, 31075491, 31111503, 9850739		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia, Hemolytic	Anemia	CTD_human_DG	2876430		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia, Hemolytic	Anemia	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia, Hemolytic, Acquired	Anemia	CTD_human_DG	2876430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic, Congenital	Anemia	BEFREE	8244340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic, Congenital Nonspherocytic	Anemia	CTD_human_DG	8503454		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia, Microangiopathic	Anemia	CTD_human_DG	2876430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	22226179	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29936416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11725301, 16938542, 17117951, 17570927, 18244953, 18727494, 19494522, 21605124, 23406933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29936416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29698674, 30590210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	15146421, 16938542, 23406933, 28103916, 31044630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	31644615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	24636202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	14662653, 19582718, 28464854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16048908, 22664934	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	38134103	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31358938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	29396807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholecystitis	Cholecystitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic hemolytic anemia	Hemolytic anemia	BEFREE	669702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic hemolytic anemia	Hemolytic anemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19288104, 25901475, 29491068, 31461438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25206290, 32802869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31708650	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30230666, 30551588, 31129929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	10701587, 20214085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	15146421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	15146421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	30450924, 31710340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	16940744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	18840520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35712251	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	30392450	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	8244340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	16940744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enzymopathy	Enzymopathy	GENOMICS_ENGLAND_DG	11698297, 7485100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enzymopathy	Enzymopathy	BEFREE	16980388, 18458110, 669702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	19374891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Osteochondritis Dissecans	Osteochondritis Dissecans	BEFREE	21605124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Foley-Denny-Brown Syndrome	Benign fasciculation-cramp syndrome	CTD_human_DG	8503454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29396807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29396807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25286751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34573317	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	28408386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30230666, 30551588, 31129929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoalphalipoproteinemias	Hypoalphalipoproteinemia	Pubtator	7816830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27765905	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	30924565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inborn Errors of Metabolism	Inborn Errors Of Metabolism	CTD_human_DG	2876430, 8503454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	31075491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29985717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Latent Autoimmune Diabetes in Adults	Latent autoimmune diabetes in adults	Pubtator	8503454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukomalacia, Periventricular	Periventricular Leukomalacia	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29113224, 30526680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	12644837, 35126788, 35246510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19116456	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	15146421, 21367814, 28371471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	28489783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28489783	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	28408386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	14662653, 19582718, 28464854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31358938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	CTD_human_DG	15274141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	18309519, 28489783, 28737830, 29307852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20544786, 24336162, 29113224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	30601716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	14662653, 16048908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10049939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12051920, 28848066		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12051920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28341520, 9125215, 9850739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microangiopathic hemolytic anemia	Microangiopathic hemolytic anemia	CTD_human_DG	2876430		★★★★★ ★☆☆☆☆ Found in Text Mining only
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	10878669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	CTD_human_DG	15274141		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	LHGDN	17015754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	35802752	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	21454294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	33102573	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10049939, 12051920, 19424580, 22081375, 24336162, 27908734, 28489783, 28688945, 28737830, 28771750, 29399413, 29491068, 29856481, 30069931, 31076549 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	10655478, 12023819, 17008404, 27857231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24614897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	27765905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular disease	Pubtator	10556207, 2876430, 8503454	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	669702		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuromuscular Diseases	Neuromuscular Diseases	CTD_human_DG	8503454		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuropathy	Neuropathy	BEFREE	31075491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropsychiatric Systemic Lupus Erythematosus	Neuropsychiatric Systemic Lupus Erythematosus	BEFREE	28451873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nodular Goiter	Nodular Goiter	BEFREE	30235493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Normocytic anemia	Anemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Oppenheim`s Disease	Oppenheim`s Disease	CTD_human_DG	8503454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	15146421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	CTD_human_DG	18924182		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis, Age-Related	Osteoporosis	CTD_human_DG	18924182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis, Senile	Osteoporosis	CTD_human_DG	18924182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30235493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	BEFREE	31078776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Osteoporosis	Osteoporosis	CTD_human_DG	18924182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	19374891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	30450924, 31710340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	31710340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35242214	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	29392553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15146421, 30730912, 31044630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	34233293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22623148		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	22623148		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	29491068, 30350179, 30445951, 30547679, 30628113, 30838483, 31591140, 31611243, 31838590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	25899833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	27102916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	15274141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	CTD_human_DG	21517111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	38102653	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	18309519, 28489783, 28737830, 29307852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26911362, 28489783	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28103916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	28701681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triose phosphate isomerase deficiency	Triosephosphate Isomerase Deficiency	BEFREE	20374271		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Triose phosphate isomerase deficiency	Triosephosphate Isomerase Deficiency	ORPHANET_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Triose phosphate-isomerase deficiency	Triosephosphate Isomerase Deficiency	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Triosephosphate Isomerase Deficiency	Triose phosphate isomerase deficiency	Pubtator	10556207, 11698297, 35315486	Associate	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Triosephosphate Isomerase Deficiency	Triosephosphate Isomerase Deficiency	CLINVAR_DG	10910933, 11196750, 17183658, 18562316, 20374271, 24056040, 24192681, 24840153, 26863999, 27717089, 2876430, 7485100, 7628118, 9338582, 9842650		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Triosephosphate Isomerase Deficiency	Triosephosphate Isomerase Deficiency	GENOMICS_ENGLAND_DG	11698297, 7485100		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Triosephosphate Isomerase Deficiency	Triose phosphate isomerase deficiency	Pubtator	11698297, 8503454	Inhibit	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Triosephosphate Isomerase Deficiency	Triosephosphate Isomerase Deficiency	UNIPROT_DG	2876430, 8503454, 8571957, 9338582		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Triosephosphate Isomerase Deficiency	Triosephosphate Isomerase Deficiency	CTD_human_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Triosephosphate Isomerase Deficiency	Triosephosphate Isomerase Deficiency	ORPHANET_DG			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23504277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	22570344		★★★★★ ★☆☆☆☆ Found in Text Mining only

TPI1 (triosephosphate isomerase 1)