TPD52 (tumor protein D52)

Gene

• Entrez ID: 7163
• Gene name: Tumor protein D52
• Gene symbol: TPD52
• Synonyms (NCBI Gene): D52, N8L, PC-1, PrLZ, hD52
• Chromosome: 8
• Chromosome location: 8q21.13

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021038	hsa-miR-155-5p	Proteomics	18668040
MIRT024215	hsa-miR-218-5p	Sequencing	20371350
MIRT025584	hsa-miR-34a-5p	Sequencing	20371350
MIRT025584	hsa-miR-34a-5p	Proteomics	21566225
MIRT027218	hsa-miR-103a-3p	Sequencing	20371350
MIRT046423	hsa-miR-15b-5p	CLASH	23622248
MIRT041053	hsa-miR-505-3p	CLASH	23622248
MIRT437894	hsa-miR-224-5p	5.0	24768995
MIRT437894	hsa-miR-224-5p	5.0	24768995
MIRT024215	hsa-miR-218-5p	PAR-CLIP	20371350
MIRT546197	hsa-miR-3121-3p	PAR-CLIP	20371350
MIRT546193	hsa-miR-512-3p	PAR-CLIP	20371350
MIRT546192	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT546191	hsa-miR-520f-3p	PAR-CLIP	20371350
MIRT546188	hsa-miR-3650	PAR-CLIP	20371350
MIRT546189	hsa-miR-636	PAR-CLIP	20371350
MIRT546187	hsa-miR-4473	PAR-CLIP	20371350
MIRT565265	hsa-miR-4282	PAR-CLIP	20371350
MIRT565264	hsa-miR-6792-5p	PAR-CLIP	20371350
MIRT565263	hsa-miR-4503	PAR-CLIP	20371350
MIRT565262	hsa-miR-7856-5p	PAR-CLIP	20371350
MIRT024215	hsa-miR-218-5p	PAR-CLIP	20371350
MIRT546197	hsa-miR-3121-3p	PAR-CLIP	20371350
MIRT546193	hsa-miR-512-3p	PAR-CLIP	20371350
MIRT546192	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT546191	hsa-miR-520f-3p	PAR-CLIP	20371350
MIRT546188	hsa-miR-3650	PAR-CLIP	20371350
MIRT546189	hsa-miR-636	PAR-CLIP	20371350
MIRT546187	hsa-miR-4473	PAR-CLIP	20371350
MIRT024215	hsa-miR-218-5p	PAR-CLIP	21572407
MIRT546197	hsa-miR-3121-3p	PAR-CLIP	21572407
MIRT546196	hsa-miR-4694-3p	PAR-CLIP	21572407
MIRT546195	hsa-miR-224-3p	PAR-CLIP	21572407
MIRT546194	hsa-miR-522-3p	PAR-CLIP	21572407
MIRT546193	hsa-miR-512-3p	PAR-CLIP	21572407
MIRT546192	hsa-miR-302c-3p	PAR-CLIP	21572407
MIRT546191	hsa-miR-520f-3p	PAR-CLIP	21572407
MIRT546190	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT546188	hsa-miR-3650	PAR-CLIP	21572407
MIRT546189	hsa-miR-636	PAR-CLIP	21572407
MIRT546187	hsa-miR-4473	PAR-CLIP	21572407
MIRT505309	hsa-miR-379-5p	PAR-CLIP	23446348
MIRT505308	hsa-miR-3529-5p	PAR-CLIP	23446348
MIRT505307	hsa-miR-6835-3p	PAR-CLIP	23446348
MIRT505306	hsa-miR-320c	PAR-CLIP	23446348
MIRT505305	hsa-miR-320a	PAR-CLIP	23446348
MIRT505304	hsa-miR-320d	PAR-CLIP	23446348
MIRT505303	hsa-miR-4429	PAR-CLIP	23446348
MIRT505302	hsa-miR-320b	PAR-CLIP	23446348
MIRT505301	hsa-miR-5692a	PAR-CLIP	23446348
MIRT505300	hsa-miR-4760-3p	PAR-CLIP	23446348
MIRT505299	hsa-miR-5680	PAR-CLIP	23446348
MIRT505298	hsa-miR-4490	PAR-CLIP	23446348
MIRT505297	hsa-miR-4774-5p	PAR-CLIP	23446348
MIRT505296	hsa-miR-4650-3p	PAR-CLIP	23446348
MIRT505295	hsa-miR-4451	PAR-CLIP	23446348
MIRT505294	hsa-miR-9-3p	PAR-CLIP	23446348
MIRT449540	hsa-miR-4311	PAR-CLIP	22100165
MIRT449539	hsa-miR-6804-5p	PAR-CLIP	22100165
MIRT449538	hsa-miR-6721-5p	PAR-CLIP	22100165
MIRT449537	hsa-miR-6834-5p	PAR-CLIP	22100165
MIRT449536	hsa-miR-1226-5p	PAR-CLIP	22100165
MIRT449535	hsa-miR-6734-5p	PAR-CLIP	22100165
MIRT731901	hsa-miR-139-5p	Luciferase reporter assay, qRT-PCR, Western blot	27785063
MIRT731901	hsa-miR-139-5p	Luciferase reporter assay, qRT-PCR, Western blot	27785063
MIRT731901	hsa-miR-139-5p	Luciferase reporter assay, qRT-PCR, Western blot	27785063
MIRT731901	hsa-miR-139-5p	Luciferase reporter assay, qRT-PCR, Western blot	27785063
MIRT024215	hsa-miR-218-5p	PAR-CLIP	20371350
MIRT546197	hsa-miR-3121-3p	PAR-CLIP	20371350
MIRT546193	hsa-miR-512-3p	PAR-CLIP	20371350
MIRT546192	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT546191	hsa-miR-520f-3p	PAR-CLIP	20371350
MIRT546188	hsa-miR-3650	PAR-CLIP	20371350
MIRT546189	hsa-miR-636	PAR-CLIP	20371350
MIRT546187	hsa-miR-4473	PAR-CLIP	20371350
MIRT565265	hsa-miR-4282	PAR-CLIP	20371350
MIRT565264	hsa-miR-6792-5p	PAR-CLIP	20371350
MIRT565263	hsa-miR-4503	PAR-CLIP	20371350
MIRT565262	hsa-miR-7856-5p	PAR-CLIP	20371350
MIRT024215	hsa-miR-218-5p	PAR-CLIP	20371350
MIRT546197	hsa-miR-3121-3p	PAR-CLIP	20371350
MIRT546193	hsa-miR-512-3p	PAR-CLIP	20371350
MIRT546192	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT546191	hsa-miR-520f-3p	PAR-CLIP	20371350
MIRT546188	hsa-miR-3650	PAR-CLIP	20371350
MIRT546189	hsa-miR-636	PAR-CLIP	20371350
MIRT546187	hsa-miR-4473	PAR-CLIP	20371350
MIRT024215	hsa-miR-218-5p	PAR-CLIP	21572407
MIRT546197	hsa-miR-3121-3p	PAR-CLIP	21572407
MIRT546196	hsa-miR-4694-3p	PAR-CLIP	21572407
MIRT546195	hsa-miR-224-3p	PAR-CLIP	21572407
MIRT546194	hsa-miR-522-3p	PAR-CLIP	21572407
MIRT546193	hsa-miR-512-3p	PAR-CLIP	21572407
MIRT546192	hsa-miR-302c-3p	PAR-CLIP	21572407
MIRT546191	hsa-miR-520f-3p	PAR-CLIP	21572407
MIRT546190	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT546188	hsa-miR-3650	PAR-CLIP	21572407
MIRT546189	hsa-miR-636	PAR-CLIP	21572407
MIRT546187	hsa-miR-4473	PAR-CLIP	21572407
MIRT505309	hsa-miR-379-5p	PAR-CLIP	23446348
MIRT505308	hsa-miR-3529-5p	PAR-CLIP	23446348
MIRT505307	hsa-miR-6835-3p	PAR-CLIP	23446348
MIRT505306	hsa-miR-320c	PAR-CLIP	23446348
MIRT505305	hsa-miR-320a	PAR-CLIP	23446348
MIRT505304	hsa-miR-320d	PAR-CLIP	23446348
MIRT505303	hsa-miR-4429	PAR-CLIP	23446348
MIRT505302	hsa-miR-320b	PAR-CLIP	23446348
MIRT505301	hsa-miR-5692a	PAR-CLIP	23446348
MIRT505300	hsa-miR-4760-3p	PAR-CLIP	23446348
MIRT505299	hsa-miR-5680	PAR-CLIP	23446348
MIRT505298	hsa-miR-4490	PAR-CLIP	23446348
MIRT505297	hsa-miR-4774-5p	PAR-CLIP	23446348
MIRT505296	hsa-miR-4650-3p	PAR-CLIP	23446348
MIRT505295	hsa-miR-4451	PAR-CLIP	23446348
MIRT505294	hsa-miR-9-3p	PAR-CLIP	23446348
MIRT449540	hsa-miR-4311	PAR-CLIP	22100165
MIRT449539	hsa-miR-6804-5p	PAR-CLIP	22100165
MIRT449538	hsa-miR-6721-5p	PAR-CLIP	22100165
MIRT449537	hsa-miR-6834-5p	PAR-CLIP	22100165
MIRT449536	hsa-miR-1226-5p	PAR-CLIP	22100165
MIRT449535	hsa-miR-6734-5p	PAR-CLIP	22100165
MIRT755338	hsa-miR-125b-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35320453
MIRT1449055	hsa-miR-103a	CLIP-seq
MIRT1449056	hsa-miR-107	CLIP-seq
MIRT1449057	hsa-miR-1206	CLIP-seq
MIRT1449058	hsa-miR-1256	CLIP-seq
MIRT1449059	hsa-miR-1271	CLIP-seq
MIRT1449060	hsa-miR-1301	CLIP-seq
MIRT1449061	hsa-miR-141	CLIP-seq
MIRT1449062	hsa-miR-182	CLIP-seq
MIRT1449063	hsa-miR-186	CLIP-seq
MIRT1449064	hsa-miR-18a	CLIP-seq
MIRT1449065	hsa-miR-18b	CLIP-seq
MIRT1449066	hsa-miR-200a	CLIP-seq
MIRT1449067	hsa-miR-3124-3p	CLIP-seq
MIRT1449068	hsa-miR-3126-3p	CLIP-seq
MIRT1449069	hsa-miR-3128	CLIP-seq
MIRT1449070	hsa-miR-3132	CLIP-seq
MIRT1449071	hsa-miR-3133	CLIP-seq
MIRT1449072	hsa-miR-3143	CLIP-seq
MIRT1449073	hsa-miR-3157-5p	CLIP-seq
MIRT1449074	hsa-miR-3180-5p	CLIP-seq
MIRT1449075	hsa-miR-3189-3p	CLIP-seq
MIRT1449076	hsa-miR-34a	CLIP-seq
MIRT1449077	hsa-miR-34c-5p	CLIP-seq
MIRT1449078	hsa-miR-3647-3p	CLIP-seq
MIRT1449079	hsa-miR-3689d	CLIP-seq
MIRT1449080	hsa-miR-376a	CLIP-seq
MIRT1449081	hsa-miR-376b	CLIP-seq
MIRT1449082	hsa-miR-382	CLIP-seq
MIRT1449083	hsa-miR-3974	CLIP-seq
MIRT1449084	hsa-miR-4255	CLIP-seq
MIRT1449085	hsa-miR-4263	CLIP-seq
MIRT1449086	hsa-miR-432	CLIP-seq
MIRT1449087	hsa-miR-4327	CLIP-seq
MIRT1449088	hsa-miR-4420	CLIP-seq
MIRT1449089	hsa-miR-4436a	CLIP-seq
MIRT1449090	hsa-miR-4443	CLIP-seq
MIRT1449091	hsa-miR-449a	CLIP-seq
MIRT1449092	hsa-miR-449b	CLIP-seq
MIRT1449093	hsa-miR-4540	CLIP-seq
MIRT1449094	hsa-miR-4639-5p	CLIP-seq
MIRT1449095	hsa-miR-4642	CLIP-seq
MIRT1449096	hsa-miR-4645-3p	CLIP-seq
MIRT1449097	hsa-miR-4691-3p	CLIP-seq
MIRT1449098	hsa-miR-4700-3p	CLIP-seq
MIRT1449099	hsa-miR-4704-3p	CLIP-seq
MIRT1449100	hsa-miR-4714-3p	CLIP-seq
MIRT1449101	hsa-miR-4720-5p	CLIP-seq
MIRT1449102	hsa-miR-4724-5p	CLIP-seq
MIRT1449103	hsa-miR-4735-3p	CLIP-seq
MIRT1449104	hsa-miR-4743	CLIP-seq
MIRT1449105	hsa-miR-4799-3p	CLIP-seq
MIRT1449106	hsa-miR-495	CLIP-seq
MIRT1449107	hsa-miR-502-5p	CLIP-seq
MIRT1449108	hsa-miR-5047	CLIP-seq
MIRT1449109	hsa-miR-516b	CLIP-seq
MIRT1449110	hsa-miR-520a-5p	CLIP-seq
MIRT1449111	hsa-miR-525-5p	CLIP-seq
MIRT1449112	hsa-miR-543	CLIP-seq
MIRT1449113	hsa-miR-618	CLIP-seq
MIRT1449114	hsa-miR-96	CLIP-seq
MIRT2134344	hsa-miR-1250	CLIP-seq
MIRT2134345	hsa-miR-1279	CLIP-seq
MIRT2134346	hsa-miR-1323	CLIP-seq
MIRT2134347	hsa-miR-224	CLIP-seq
MIRT1449067	hsa-miR-3124-3p	CLIP-seq
MIRT1449076	hsa-miR-34a	CLIP-seq
MIRT1449077	hsa-miR-34c-5p	CLIP-seq
MIRT2134348	hsa-miR-369-3p	CLIP-seq
MIRT2134349	hsa-miR-374a	CLIP-seq
MIRT2134350	hsa-miR-374b	CLIP-seq
MIRT2134351	hsa-miR-409-5p	CLIP-seq
MIRT2134352	hsa-miR-4266	CLIP-seq
MIRT2134353	hsa-miR-4422	CLIP-seq
MIRT2134354	hsa-miR-4436b-5p	CLIP-seq
MIRT1449091	hsa-miR-449a	CLIP-seq
MIRT1449092	hsa-miR-449b	CLIP-seq
MIRT2134355	hsa-miR-4639-3p	CLIP-seq
MIRT2134356	hsa-miR-4693-5p	CLIP-seq
MIRT2134357	hsa-miR-4695-5p	CLIP-seq
MIRT2134358	hsa-miR-4719	CLIP-seq
MIRT1449101	hsa-miR-4720-5p	CLIP-seq
MIRT2134359	hsa-miR-4779	CLIP-seq
MIRT1449105	hsa-miR-4799-3p	CLIP-seq
MIRT2134360	hsa-miR-483-3p	CLIP-seq
MIRT1449106	hsa-miR-495	CLIP-seq
MIRT2134361	hsa-miR-513c	CLIP-seq
MIRT2134362	hsa-miR-514b-5p	CLIP-seq
MIRT1449109	hsa-miR-516b	CLIP-seq
MIRT2134363	hsa-miR-520d-5p	CLIP-seq
MIRT2134364	hsa-miR-524-5p	CLIP-seq
MIRT2134365	hsa-miR-548o	CLIP-seq
MIRT2134366	hsa-miR-553	CLIP-seq
MIRT2134367	hsa-miR-616	CLIP-seq
MIRT2134368	hsa-miR-668	CLIP-seq
MIRT2355576	hsa-miR-101	CLIP-seq
MIRT1449055	hsa-miR-103a	CLIP-seq
MIRT1449056	hsa-miR-107	CLIP-seq
MIRT2134344	hsa-miR-1250	CLIP-seq
MIRT1449058	hsa-miR-1256	CLIP-seq
MIRT1449059	hsa-miR-1271	CLIP-seq
MIRT2134345	hsa-miR-1279	CLIP-seq
MIRT2355577	hsa-miR-129-3p	CLIP-seq
MIRT1449060	hsa-miR-1301	CLIP-seq
MIRT2355578	hsa-miR-1305	CLIP-seq
MIRT2355579	hsa-miR-133a	CLIP-seq
MIRT2355580	hsa-miR-133b	CLIP-seq
MIRT2355581	hsa-miR-144	CLIP-seq
MIRT2355582	hsa-miR-155	CLIP-seq
MIRT2355583	hsa-miR-181a	CLIP-seq
MIRT2355584	hsa-miR-181b	CLIP-seq
MIRT2355585	hsa-miR-181c	CLIP-seq
MIRT2355586	hsa-miR-181d	CLIP-seq
MIRT1449062	hsa-miR-182	CLIP-seq
MIRT2134347	hsa-miR-224	CLIP-seq
MIRT2355587	hsa-miR-27a	CLIP-seq
MIRT2355588	hsa-miR-27b	CLIP-seq
MIRT1449068	hsa-miR-3126-3p	CLIP-seq
MIRT1449069	hsa-miR-3128	CLIP-seq
MIRT1449070	hsa-miR-3132	CLIP-seq
MIRT1449072	hsa-miR-3143	CLIP-seq
MIRT2355589	hsa-miR-3144-3p	CLIP-seq
MIRT2355590	hsa-miR-3145-3p	CLIP-seq
MIRT2355591	hsa-miR-3145-5p	CLIP-seq
MIRT2355592	hsa-miR-3179	CLIP-seq
MIRT1449074	hsa-miR-3180-5p	CLIP-seq
MIRT2355593	hsa-miR-323b-3p	CLIP-seq
MIRT1449076	hsa-miR-34a	CLIP-seq
MIRT1449077	hsa-miR-34c-5p	CLIP-seq
MIRT2355594	hsa-miR-3682-5p	CLIP-seq
MIRT2134349	hsa-miR-374a	CLIP-seq
MIRT2134350	hsa-miR-374b	CLIP-seq
MIRT2355595	hsa-miR-380	CLIP-seq
MIRT2355596	hsa-miR-3973	CLIP-seq
MIRT1449083	hsa-miR-3974	CLIP-seq
MIRT2355597	hsa-miR-4262	CLIP-seq
MIRT2134352	hsa-miR-4266	CLIP-seq
MIRT2355598	hsa-miR-4299	CLIP-seq
MIRT1449087	hsa-miR-4327	CLIP-seq
MIRT2355599	hsa-miR-4328	CLIP-seq
MIRT2134354	hsa-miR-4436b-5p	CLIP-seq
MIRT2355600	hsa-miR-4453	CLIP-seq
MIRT2355601	hsa-miR-4456	CLIP-seq
MIRT2355602	hsa-miR-4477a	CLIP-seq
MIRT2355603	hsa-miR-4495	CLIP-seq
MIRT1449091	hsa-miR-449a	CLIP-seq
MIRT1449092	hsa-miR-449b	CLIP-seq
MIRT2355604	hsa-miR-4509	CLIP-seq
MIRT2355605	hsa-miR-4517	CLIP-seq
MIRT2355606	hsa-miR-4535	CLIP-seq
MIRT2355607	hsa-miR-4538	CLIP-seq
MIRT1449093	hsa-miR-4540	CLIP-seq
MIRT2355608	hsa-miR-4637	CLIP-seq
MIRT2134355	hsa-miR-4639-3p	CLIP-seq
MIRT1449095	hsa-miR-4642	CLIP-seq
MIRT2355609	hsa-miR-4668-3p	CLIP-seq
MIRT2355610	hsa-miR-4690-3p	CLIP-seq
MIRT1449097	hsa-miR-4691-3p	CLIP-seq
MIRT2134357	hsa-miR-4695-5p	CLIP-seq
MIRT2355611	hsa-miR-4699-5p	CLIP-seq
MIRT2355612	hsa-miR-4704-5p	CLIP-seq
MIRT2355613	hsa-miR-4711-3p	CLIP-seq
MIRT2134358	hsa-miR-4719	CLIP-seq
MIRT1449101	hsa-miR-4720-5p	CLIP-seq
MIRT2355614	hsa-miR-4732-3p	CLIP-seq
MIRT2134359	hsa-miR-4779	CLIP-seq
MIRT1449105	hsa-miR-4799-3p	CLIP-seq
MIRT2134360	hsa-miR-483-3p	CLIP-seq
MIRT2355615	hsa-miR-492	CLIP-seq
MIRT1449106	hsa-miR-495	CLIP-seq
MIRT1449108	hsa-miR-5047	CLIP-seq
MIRT2355616	hsa-miR-508-5p	CLIP-seq
MIRT2355617	hsa-miR-512-5p	CLIP-seq
MIRT2355618	hsa-miR-513a-5p	CLIP-seq
MIRT2134361	hsa-miR-513c	CLIP-seq
MIRT2134362	hsa-miR-514b-5p	CLIP-seq
MIRT1449109	hsa-miR-516b	CLIP-seq
MIRT1449110	hsa-miR-520a-5p	CLIP-seq
MIRT2355619	hsa-miR-520g	CLIP-seq
MIRT2355620	hsa-miR-520h	CLIP-seq
MIRT1449111	hsa-miR-525-5p	CLIP-seq
MIRT1449112	hsa-miR-543	CLIP-seq
MIRT2355621	hsa-miR-548m	CLIP-seq
MIRT2355622	hsa-miR-548q	CLIP-seq
MIRT2134366	hsa-miR-553	CLIP-seq
MIRT2355623	hsa-miR-579	CLIP-seq
MIRT2355624	hsa-miR-582-5p	CLIP-seq
MIRT2355625	hsa-miR-586	CLIP-seq
MIRT2355626	hsa-miR-607	CLIP-seq
MIRT2355627	hsa-miR-609	CLIP-seq
MIRT2355628	hsa-miR-622	CLIP-seq
MIRT2355629	hsa-miR-627	CLIP-seq
MIRT2355630	hsa-miR-656	CLIP-seq
MIRT2134368	hsa-miR-668	CLIP-seq
MIRT2355631	hsa-miR-938	CLIP-seq
MIRT1449114	hsa-miR-96	CLIP-seq
MIRT1449101	hsa-miR-4720-5p	CLIP-seq
MIRT1449105	hsa-miR-4799-3p	CLIP-seq
MIRT2396245	hsa-miR-4643	CLIP-seq
MIRT2396246	hsa-miR-4717-3p	CLIP-seq
MIRT1449104	hsa-miR-4743	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IDA	15576473
GO:0005515	Function	Protein binding	IPI	9484778, 12963375, 15576473, 16631610, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	15576473, 16112108
GO:0005783	Component	Endoplasmic reticulum	IDA	10942595
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0009653	Process	Anatomical structure morphogenesis	TAS	8632896
GO:0030183	Process	B cell differentiation	IBA
GO:0030183	Process	B cell differentiation	IEP	15576473
GO:0042803	Function	Protein homodimerization activity	IDA	9484778
GO:0046903	Process	Secretion	TAS	15576473
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	16112108

Other IDs

• MIM: 604068
• HGNC: 12005
• e!Ensembl: ENSG00000076554

Protein

• UniProt ID: P55327
• Protein name: Tumor protein D52 (Protein N8)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04201	TPD52	49 → 210	Tumour protein D52 family	Family

• Tissue specificity: TISSUE SPECIFICITY: Isoform 2 is expressed in colon, breast, prostate, pancreas and kidney tumor cell lines. Isoform 2 is expressed at high levels in kidney, prostate, brain, small intestine and pancreas, at moderate levels in placenta and colon, at low l
• Sequence:

  MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKFGLLRTDPVPEEGED
  VAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELK
  QNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEK
  VENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL

• Sequence length: 224

Pathways

Reactome:

Golgi Associated Vesicle Biogenesis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISORDER OF DEVELOPMENT OR MORPHOGENESIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOCUTANEOUS LYMPH NODE SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenoma	Adenoma	BEFREE	15986428		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	31170943	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain neoplasms	Pubtator	35577881	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	17487680		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10918393, 11549320, 12963375, 17005433, 18959755, 23661506, 25629696, 26678891, 27983918, 31206033, 31649118, 7796418, 8812487, 9484778, 9730602		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18959755	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20139910, 25629696, 27983918, 31755218, 33490232	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26575170, 37098483	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15986428, 16620967		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25912578	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26575170	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	20846453	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27633630, 27765924	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15986428		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	31661142		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	17163815		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	18710659		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28562687		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18710659		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28562687	Associate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	31661142		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27983909		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15126519, 16087305		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15126519, 16087305		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10969847, 10969849, 15126519, 16186408, 31250990		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	12147786		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	12547881, 31250990		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	27623942		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	27623942	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	39684695	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26781422		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24842331		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	30221720, 35577881	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemangioma	Hemangioma	BEFREE	31542613		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	10707036		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	15126519		★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	10707036		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	17163815		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30203488		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26575170		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	39625996	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37564195	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26575170	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17005433, 18959755, 23661506, 26678891, 27983918, 31206033, 31649118		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	27623942		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15986428		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29039566, 31847526		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14996714, 15172988, 17418805, 17875733, 18959755, 19732746, 23104178, 23661456, 24768995, 25511701, 26846108, 27070713, 27694690, 28466782, 29290796, 30981892, 31278300		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17875733, 27415467		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15555543, 23529586, 24317684, 24768995, 24842331, 25511701, 26575170, 27633630, 27983909, 30203488, 30981892		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18698023		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	8579579		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	10969847, 17990211		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	18959755	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	16186408		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	31350893		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15986428, 19041365, 24317684, 26575170, 27983909, 28562687, 28798933, 31847526, 7796418		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28436114		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	11739459, 17026496, 21565692, 22327785		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15986428		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15986428		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20846453, 37833790	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29039566, 31847526		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	18690303, 31250990		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	LHGDN	16620967		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	LHGDN	16620967		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14996714, 15172988, 15986428, 17418805, 17875733, 18959755, 19732746, 23661456, 24768995, 25511701, 26846108, 27070713, 27694690, 28466782, 29290796, 30981892		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17418805, 17947466		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17875733, 27415467		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18959755, 19732746, 23661456, 24768995, 26501111, 26846108, 27070713, 27694690, 28466782, 30271587, 30397274, 30981892, 33976535, 34034634, 35194188	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27983909		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11168012		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	24390342, 30423114		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	24390342		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seminoma	Seminoma	BEFREE	19041365		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	31366407	Stimulate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	37098483	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	27633630		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35222884	Stimulate	★☆☆☆☆ Found in Text Mining only