Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	7162
Gene name	Trophoblast glycoprotein
Gene symbol	TPBG
Synonyms (NCBI Gene)	5T45T4AGM6P1WAIF1
Chromosome	6
Chromosome location	6q14.1
Summary	This gene encodes a leucine-rich transmembrane glycoprotein that may be involved in cell adhesion. The encoded protein is an oncofetal antigen that is specific to trophoblast cells. In adults this protein is highly expressed in many tumor cells and is ass

169

Show/Hide all (169)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020868	hsa-miR-155-5p	Proteomics	18668040
MIRT028555	hsa-miR-30a-5p	Proteomics	18668040
MIRT031878	hsa-miR-16-5p	Proteomics	18668040
MIRT032386	hsa-let-7b-5p	Proteomics	18668040
MIRT041063	hsa-miR-505-3p	CLASH	23622248
MIRT528648	hsa-miR-33a-3p	PAR-CLIP	22012620
MIRT528647	hsa-miR-141-5p	PAR-CLIP	22012620
MIRT528645	hsa-miR-6830-5p	PAR-CLIP	22012620
MIRT361344	hsa-miR-208a-5p	PAR-CLIP	24398324
MIRT361346	hsa-miR-208b-5p	PAR-CLIP	24398324
MIRT361349	hsa-miR-1827	PAR-CLIP	24398324
MIRT361350	hsa-miR-3140-3p	PAR-CLIP	24398324
MIRT499259	hsa-miR-516a-5p	PAR-CLIP	24398324
MIRT499258	hsa-miR-6765-5p	PAR-CLIP	24398324
MIRT392440	hsa-miR-653-5p	PAR-CLIP	24398324
MIRT361347	hsa-miR-1304-5p	PAR-CLIP	24398324
MIRT528648	hsa-miR-33a-3p	PAR-CLIP	22012620
MIRT528647	hsa-miR-141-5p	PAR-CLIP	22012620
MIRT528645	hsa-miR-6830-5p	PAR-CLIP	22012620
MIRT361344	hsa-miR-208a-5p	PAR-CLIP	24398324
MIRT361346	hsa-miR-208b-5p	PAR-CLIP	24398324
MIRT361349	hsa-miR-1827	PAR-CLIP	24398324
MIRT361350	hsa-miR-3140-3p	PAR-CLIP	24398324
MIRT499259	hsa-miR-516a-5p	PAR-CLIP	24398324
MIRT499258	hsa-miR-6765-5p	PAR-CLIP	24398324
MIRT392440	hsa-miR-653-5p	PAR-CLIP	24398324
MIRT361347	hsa-miR-1304-5p	PAR-CLIP	24398324
MIRT1448920	hsa-miR-1206	CLIP-seq
MIRT1448921	hsa-miR-1324	CLIP-seq
MIRT1448922	hsa-miR-298	CLIP-seq
MIRT1448923	hsa-miR-3120-3p	CLIP-seq
MIRT1448924	hsa-miR-323-3p	CLIP-seq
MIRT1448925	hsa-miR-329	CLIP-seq
MIRT1448926	hsa-miR-3605-5p	CLIP-seq
MIRT1448927	hsa-miR-3613-3p	CLIP-seq
MIRT1448928	hsa-miR-362-3p	CLIP-seq
MIRT1448929	hsa-miR-3944-5p	CLIP-seq
MIRT1448930	hsa-miR-451b	CLIP-seq
MIRT1448931	hsa-miR-452	CLIP-seq
MIRT1448932	hsa-miR-4523	CLIP-seq
MIRT1448933	hsa-miR-4676-3p	CLIP-seq
MIRT1448934	hsa-miR-4796-3p	CLIP-seq
MIRT1448935	hsa-miR-548a-5p	CLIP-seq
MIRT1448936	hsa-miR-548ab	CLIP-seq
MIRT1448937	hsa-miR-548ak	CLIP-seq
MIRT1448938	hsa-miR-548b-5p	CLIP-seq
MIRT1448939	hsa-miR-548c-5p	CLIP-seq
MIRT1448940	hsa-miR-548d-5p	CLIP-seq
MIRT1448941	hsa-miR-548g	CLIP-seq
MIRT1448942	hsa-miR-548h	CLIP-seq
MIRT1448943	hsa-miR-548i	CLIP-seq
MIRT1448944	hsa-miR-548j	CLIP-seq
MIRT1448945	hsa-miR-548n	CLIP-seq
MIRT1448946	hsa-miR-548w	CLIP-seq
MIRT1448947	hsa-miR-548y	CLIP-seq
MIRT1448948	hsa-miR-559	CLIP-seq
MIRT1448949	hsa-miR-600	CLIP-seq
MIRT1448950	hsa-miR-1224-5p	CLIP-seq
MIRT1448951	hsa-miR-1284	CLIP-seq
MIRT1448952	hsa-miR-1304	CLIP-seq
MIRT1448921	hsa-miR-1324	CLIP-seq
MIRT1448923	hsa-miR-3120-3p	CLIP-seq
MIRT1448953	hsa-miR-3150b-3p	CLIP-seq
MIRT1448954	hsa-miR-3915	CLIP-seq
MIRT1448930	hsa-miR-451b	CLIP-seq
MIRT1448955	hsa-miR-4641	CLIP-seq
MIRT1448956	hsa-miR-4689	CLIP-seq
MIRT1448957	hsa-miR-4731-3p	CLIP-seq
MIRT1448958	hsa-miR-4784	CLIP-seq
MIRT1448959	hsa-miR-4789-5p	CLIP-seq
MIRT1448960	hsa-miR-4801	CLIP-seq
MIRT1448961	hsa-miR-653	CLIP-seq
MIRT1448920	hsa-miR-1206	CLIP-seq
MIRT1448922	hsa-miR-298	CLIP-seq
MIRT2134329	hsa-miR-607	CLIP-seq
MIRT1448924	hsa-miR-323-3p	CLIP-seq
MIRT2134330	hsa-miR-3614-3p	CLIP-seq
MIRT1448920	hsa-miR-1206	CLIP-seq
MIRT1448951	hsa-miR-1284	CLIP-seq
MIRT2355529	hsa-miR-221	CLIP-seq
MIRT2355530	hsa-miR-222	CLIP-seq
MIRT1448924	hsa-miR-323-3p	CLIP-seq
MIRT1448926	hsa-miR-3605-5p	CLIP-seq
MIRT2355531	hsa-miR-3681	CLIP-seq
MIRT2355532	hsa-miR-3973	CLIP-seq
MIRT2355533	hsa-miR-4420	CLIP-seq
MIRT1448957	hsa-miR-4731-3p	CLIP-seq
MIRT1448959	hsa-miR-4789-5p	CLIP-seq
MIRT1448960	hsa-miR-4801	CLIP-seq
MIRT2355534	hsa-miR-520g	CLIP-seq
MIRT2355535	hsa-miR-520h	CLIP-seq
MIRT2355536	hsa-miR-548v	CLIP-seq
MIRT1448949	hsa-miR-600	CLIP-seq
MIRT2355537	hsa-miR-765	CLIP-seq
MIRT2434300	hsa-miR-3127-3p	CLIP-seq
MIRT2355533	hsa-miR-4420	CLIP-seq
MIRT2434301	hsa-miR-605	CLIP-seq
MIRT1448920	hsa-miR-1206	CLIP-seq
MIRT1448923	hsa-miR-3120-3p	CLIP-seq
MIRT1448930	hsa-miR-451b	CLIP-seq
MIRT1448955	hsa-miR-4641	CLIP-seq
MIRT2441494	hsa-miR-4716-5p	CLIP-seq
MIRT2441495	hsa-miR-4728-3p	CLIP-seq
MIRT1448920	hsa-miR-1206	CLIP-seq
MIRT1448950	hsa-miR-1224-5p	CLIP-seq
MIRT1448951	hsa-miR-1284	CLIP-seq
MIRT2649136	hsa-miR-142-5p	CLIP-seq
MIRT2649137	hsa-miR-1470	CLIP-seq
MIRT1448923	hsa-miR-3120-3p	CLIP-seq
MIRT2649138	hsa-miR-3145-3p	CLIP-seq
MIRT1448953	hsa-miR-3150b-3p	CLIP-seq
MIRT1448924	hsa-miR-323-3p	CLIP-seq
MIRT1448925	hsa-miR-329	CLIP-seq
MIRT1448928	hsa-miR-362-3p	CLIP-seq
MIRT1448954	hsa-miR-3915	CLIP-seq
MIRT1448930	hsa-miR-451b	CLIP-seq
MIRT1448932	hsa-miR-4523	CLIP-seq
MIRT1448955	hsa-miR-4641	CLIP-seq
MIRT2649139	hsa-miR-4667-3p	CLIP-seq
MIRT2649140	hsa-miR-4668-3p	CLIP-seq
MIRT1448956	hsa-miR-4689	CLIP-seq
MIRT2441494	hsa-miR-4716-5p	CLIP-seq
MIRT2441495	hsa-miR-4728-3p	CLIP-seq
MIRT1448957	hsa-miR-4731-3p	CLIP-seq
MIRT1448958	hsa-miR-4784	CLIP-seq
MIRT1448959	hsa-miR-4789-5p	CLIP-seq
MIRT1448960	hsa-miR-4801	CLIP-seq
MIRT1448935	hsa-miR-548a-5p	CLIP-seq
MIRT1448936	hsa-miR-548ab	CLIP-seq
MIRT1448937	hsa-miR-548ak	CLIP-seq
MIRT1448938	hsa-miR-548b-5p	CLIP-seq
MIRT2649141	hsa-miR-548c-3p	CLIP-seq
MIRT1448939	hsa-miR-548c-5p	CLIP-seq
MIRT1448940	hsa-miR-548d-5p	CLIP-seq
MIRT1448942	hsa-miR-548h	CLIP-seq
MIRT1448943	hsa-miR-548i	CLIP-seq
MIRT1448944	hsa-miR-548j	CLIP-seq
MIRT2649142	hsa-miR-548k	CLIP-seq
MIRT2649143	hsa-miR-548l	CLIP-seq
MIRT1448946	hsa-miR-548w	CLIP-seq
MIRT1448947	hsa-miR-548y	CLIP-seq
MIRT1448948	hsa-miR-559	CLIP-seq
MIRT1448949	hsa-miR-600	CLIP-seq
MIRT2434301	hsa-miR-605	CLIP-seq
MIRT1448920	hsa-miR-1206	CLIP-seq
MIRT1448950	hsa-miR-1224-5p	CLIP-seq
MIRT1448951	hsa-miR-1284	CLIP-seq
MIRT2649137	hsa-miR-1470	CLIP-seq
MIRT1448923	hsa-miR-3120-3p	CLIP-seq
MIRT1448953	hsa-miR-3150b-3p	CLIP-seq
MIRT1448924	hsa-miR-323-3p	CLIP-seq
MIRT1448925	hsa-miR-329	CLIP-seq
MIRT1448928	hsa-miR-362-3p	CLIP-seq
MIRT1448954	hsa-miR-3915	CLIP-seq
MIRT1448930	hsa-miR-451b	CLIP-seq
MIRT1448932	hsa-miR-4523	CLIP-seq
MIRT1448955	hsa-miR-4641	CLIP-seq
MIRT2649139	hsa-miR-4667-3p	CLIP-seq
MIRT2649140	hsa-miR-4668-3p	CLIP-seq
MIRT1448956	hsa-miR-4689	CLIP-seq
MIRT2441494	hsa-miR-4716-5p	CLIP-seq
MIRT2441495	hsa-miR-4728-3p	CLIP-seq
MIRT1448957	hsa-miR-4731-3p	CLIP-seq
MIRT1448958	hsa-miR-4784	CLIP-seq
MIRT1448959	hsa-miR-4789-5p	CLIP-seq
MIRT1448960	hsa-miR-4801	CLIP-seq
MIRT2649141	hsa-miR-548c-3p	CLIP-seq
MIRT1448949	hsa-miR-600	CLIP-seq
MIRT2434301	hsa-miR-605	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10366710
GO:0007155	Process	Cell adhesion	NAS	10366710
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008355	Process	Olfactory learning	IEA
GO:0009986	Component	Cell surface	HDA	19581412
GO:0016020	Component	Membrane	IEA
GO:0030425	Component	Dendrite	IEA
GO:0043679	Component	Axon terminus	IEA
GO:0050921	Process	Positive regulation of chemotaxis	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051932	Process	Synaptic transmission, GABAergic	IEA
GO:0051965	Process	Positive regulation of synapse assembly	IEA
GO:0060326	Process	Cell chemotaxis	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0072659	Process	Protein localization to plasma membrane	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IBA
GO:0090497	Process	Mesenchymal cell migration	IEA
GO:0140059	Process	Dendrite arborization	IEA

MIM	HGNC	e!Ensembl
190920	12004	ENSG00000146242

Q13641

Protein name

Trophoblast glycoprotein (5T4 oncofetal antigen) (5T4 oncofetal trophoblast glycoprotein) (5T4 oncotrophoblast glycoprotein) (M6P1) (Wnt-activated inhibitory factor 1) (WAIF1)

Protein function

May function as an inhibitor of Wnt/beta-catenin signaling by indirectly interacting with LRP6 and blocking Wnt3a-dependent LRP6 internalization.

PDB

4CNC , 4CNM , 6HBY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01462	LRRNT	61 → 90	Leucine rich repeat N-terminal domain	Family
PF13855	LRR_8	91 → 154	Leucine rich repeat	Repeat
PF13855	LRR_8	118 → 168	Leucine rich repeat	Repeat
PF13855	LRR_8	210 → 270	Leucine rich repeat	Repeat
PF13855	LRR_8	239 → 294	Leucine rich repeat	Repeat
PF01463	LRRCT	320 → 345	Leucine rich repeat C-terminal domain	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed by all types of trophoblasts as early as 9 weeks of development. Specific for trophoblastic cells except for amniotic epithelium. In adult tissues, the expression is limited to a few epithelial cell types but is found on a va

Sequence

MPGGCSRGPAAGDGRLRLARLALVLLGWVSSSSPTSSASSFSSSAPFLASAVSAQPPLPD
QCPALCECSEAARTVKCVNRNLTEVPTDLPAYVRNLFLTGNQLAVLPAGAFARRPPLAEL
AALNLSGSRLDEVRAGAFEHLPSLRQLDLSHNPLADLSPFAFSGSNASVSAPSPLVELIL
NHIVPPEDERQNRSFEGMVVAALLAGRALQGLRRLELASNHFLYLPRDVLAQLPSLRHLD
LSNNSLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAELQGLPHIRVFLDNNPWVCDC
HMADMVTWLKETEVVQGKDRLTCAYPEKMRNRVLLELNSADLDCDPILPPSLQTSYVFLG
IVLALIGAIFLLVLYLNRKGIKKWMHNIRDACRDHMEGYHYRYEINADPRLTNLSSNSDV

Sequence length

420

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DRY EYE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (35)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	28183528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	25738465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37495592	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11437414, 30843650, 31686124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30718962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	16222313, 31686124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24736661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31619516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	1419629, 16630022, 19221742, 31686124, 8132670, 8180020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	29736307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	19453770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33553434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	17978129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	36601116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	16222313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30718962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17013881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11708475, 25738465, 28481180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	24736661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29549047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	29959059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	29959059	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	22498111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28687750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25738465, 27757559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27323861	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	25738465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	22266911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	22266911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17013881		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32591433	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31686124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	18004564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	20224111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	2404512	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TPBG (trophoblast glycoprotein)