TP73 (tumor protein p73)

Gene

• Entrez ID: 7161
• Gene name: Tumor protein p73
• Gene symbol: TP73
• Synonyms (NCBI Gene): CILD47, P73
• Chromosome: 1
• Chromosome location: 1p36.32
• Summary: This gene encodes a member of the p53 family of transcription factors involved in cellular responses to stress and development. It maps to a region on chromosome 1p36 that is frequently deleted in neuroblastoma and other tumors, and thought to contain mul

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005603	hsa-miR-193a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	21293058
MIRT006897	hsa-miR-205-5p	qRT-PCR, Western blot	22871739
MIRT625736	hsa-miR-320a	HITS-CLIP	23824327
MIRT625735	hsa-miR-320b	HITS-CLIP	23824327
MIRT625734	hsa-miR-320c	HITS-CLIP	23824327
MIRT625733	hsa-miR-320d	HITS-CLIP	23824327
MIRT625732	hsa-miR-4429	HITS-CLIP	23824327
MIRT625731	hsa-miR-548at-5p	HITS-CLIP	23824327
MIRT625730	hsa-miR-4750-3p	HITS-CLIP	23824327
MIRT625729	hsa-miR-1180-5p	HITS-CLIP	23824327
MIRT625728	hsa-miR-7114-3p	HITS-CLIP	23824327
MIRT625727	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT625726	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT734575	hsa-miR-105-3p	qRT-PCR	33123477
MIRT625736	hsa-miR-320a	HITS-CLIP	23824327
MIRT625735	hsa-miR-320b	HITS-CLIP	23824327
MIRT625734	hsa-miR-320c	HITS-CLIP	23824327
MIRT625733	hsa-miR-320d	HITS-CLIP	23824327
MIRT625732	hsa-miR-4429	HITS-CLIP	23824327
MIRT625731	hsa-miR-548at-5p	HITS-CLIP	23824327
MIRT625730	hsa-miR-4750-3p	HITS-CLIP	23824327
MIRT625729	hsa-miR-1180-5p	HITS-CLIP	23824327
MIRT625728	hsa-miR-7114-3p	HITS-CLIP	23824327
MIRT625727	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT625726	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT1448893	hsa-miR-200b	CLIP-seq
MIRT1448894	hsa-miR-200c	CLIP-seq
MIRT1448895	hsa-miR-374c	CLIP-seq
MIRT1448896	hsa-miR-423-3p	CLIP-seq
MIRT1448897	hsa-miR-4271	CLIP-seq
MIRT1448898	hsa-miR-429	CLIP-seq
MIRT1448899	hsa-miR-4725-3p	CLIP-seq
MIRT1448900	hsa-miR-655	CLIP-seq
MIRT1448901	hsa-miR-885-5p	CLIP-seq
MIRT1448902	hsa-miR-1273f	CLIP-seq
MIRT1448903	hsa-miR-1321	CLIP-seq
MIRT1448904	hsa-miR-3162-5p	CLIP-seq
MIRT1448905	hsa-miR-3671	CLIP-seq
MIRT1448906	hsa-miR-4739	CLIP-seq
MIRT1448907	hsa-miR-4756-5p	CLIP-seq
MIRT1448908	hsa-miR-125a-5p	CLIP-seq
MIRT1448909	hsa-miR-125b	CLIP-seq
MIRT1448910	hsa-miR-1270	CLIP-seq
MIRT1448911	hsa-miR-147b	CLIP-seq
MIRT1448912	hsa-miR-210	CLIP-seq
MIRT1448913	hsa-miR-2113	CLIP-seq
MIRT1448914	hsa-miR-4319	CLIP-seq
MIRT1448915	hsa-miR-4324	CLIP-seq
MIRT1448916	hsa-miR-4531	CLIP-seq
MIRT1448917	hsa-miR-4537	CLIP-seq
MIRT1448918	hsa-miR-620	CLIP-seq
MIRT1448919	hsa-miR-943	CLIP-seq
MIRT2442763	hsa-miR-1283	CLIP-seq
MIRT2442764	hsa-miR-4698	CLIP-seq
MIRT2442765	hsa-miR-516a-3p	CLIP-seq
MIRT2462189	hsa-miR-2355-5p	CLIP-seq
MIRT2462190	hsa-miR-338-3p	CLIP-seq
MIRT2462191	hsa-miR-4450	CLIP-seq
MIRT2462192	hsa-miR-4488	CLIP-seq
MIRT2462193	hsa-miR-4530	CLIP-seq
MIRT2462194	hsa-miR-4667-5p	CLIP-seq
MIRT2462195	hsa-miR-4675	CLIP-seq
MIRT2462196	hsa-miR-4697-5p	CLIP-seq
MIRT2462197	hsa-miR-4700-5p	CLIP-seq
MIRT2462198	hsa-miR-4741	CLIP-seq
MIRT2462199	hsa-miR-637	CLIP-seq
MIRT2462200	hsa-miR-922	CLIP-seq
MIRT2442763	hsa-miR-1283	CLIP-seq
MIRT2649131	hsa-miR-3167	CLIP-seq
MIRT2649132	hsa-miR-3668	CLIP-seq
MIRT2649133	hsa-miR-4422	CLIP-seq
MIRT2442764	hsa-miR-4698	CLIP-seq
MIRT2649134	hsa-miR-5096	CLIP-seq
MIRT2442765	hsa-miR-516a-3p	CLIP-seq
MIRT2649135	hsa-miR-876-5p	CLIP-seq
MIRT2442763	hsa-miR-1283	CLIP-seq
MIRT2442764	hsa-miR-4698	CLIP-seq
MIRT2442765	hsa-miR-516a-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
E2F1	Activation	11115495;12766778;17980704
E2F1	Unknown	11988839;19188449
EGR1	Unknown	16990849
EP300	Activation	11115495
JUN	Unknown	15302867
KAT2B	Unknown	19188449
MYC	Activation	11115495
SIRT1	Unknown	19188449
TP53	Unknown	11238924;16990849
YY1	Activation	17980704

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IBA
GO:0000785	Component	Chromatin	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	16343436
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	16343436
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	24652652
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001222	Function	Transcription corepressor binding	IPI	11748232
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	16343436
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IGI	18421303
GO:0001822	Process	Kidney development	IEA
GO:0001836	Process	Release of cytochrome c from mitochondria	IEA
GO:0002039	Function	P53 binding	IEA
GO:0002039	Function	P53 binding	IPI	25417702
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	15678106
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IMP	25417702
GO:0003700	Function	DNA-binding transcription factor activity	TAS	10802655
GO:0005515	Function	Protein binding	IPI	10469568, 11275986, 11278685, 11706030, 12730672, 14729977, 15070730, 15678106, 16998810, 17592138, 18275817, 18280240, 18768816, 19218448, 19581926, 19815500, 20615966, 21725362, 22252508, 22340593, 25283809, 25331851, 30285739, 33961781, 34591642, 35044719, 37219487
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	12730672, 19490146
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005813	Component	Centrosome	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006298	Process	Mismatch repair	TAS	10391249
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006974	Process	DNA damage response	IDA	18174154
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	IMP	18634800
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	12730672
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	TAS	10391251
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009791	Process	Post-embryonic development	IEA
GO:0010468	Process	Regulation of gene expression	IMP	18634800
GO:0019901	Function	Protein kinase binding	IPI	18174154, 19490146
GO:0021766	Process	Hippocampus development	IEA
GO:0030054	Component	Cell junction	IDA
GO:0030900	Process	Forebrain development	IEA
GO:0033326	Process	Cerebrospinal fluid secretion	IEA
GO:0036064	Component	Ciliary basal body	IDA
GO:0042771	Process	Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IBA
GO:0042771	Process	Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IDA	18174154, 19490146
GO:0042771	Process	Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IEA
GO:0042802	Function	Identical protein binding	IPI	10373484, 19815500, 22340593, 22474346
GO:0042981	Process	Regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043523	Process	Regulation of neuron apoptotic process	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045597	Process	Positive regulation of cell differentiation	IEA
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0045793	Process	Positive regulation of cell size	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	15678106
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	16343436
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	25417702
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16343436, 18174154, 18421303, 19490146, 24652652
GO:0046872	Function	Metal ion binding	IEA
GO:0048546	Process	Digestive tract morphogenesis	IEA
GO:0048666	Process	Neuron development	IEA
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	IEA
GO:0051262	Process	Protein tetramerization	IEA
GO:0051726	Process	Regulation of cell cycle	IDA	18421303
GO:0060044	Process	Negative regulation of cardiac muscle cell proliferation	IMP	18634800
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	18421303
GO:0097371	Function	MDM2/MDM4 family protein binding	IEA
GO:0097371	Function	MDM2/MDM4 family protein binding	IPI	25417702
GO:0140297	Function	DNA-binding transcription factor binding	IPI	18421303
GO:1901248	Process	Positive regulation of lung ciliated cell differentiation	IMP	34077761
GO:1902167	Process	Positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IEA
GO:1990841	Function	Promoter-specific chromatin binding	IBA
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IEA

Other IDs

• MIM: 601990
• HGNC: 12003
• e!Ensembl: ENSG00000078900

Protein

• UniProt ID: O15350
• Protein name: Tumor protein p73 (p53-like transcription factor) (p53-related protein)
• Protein function: Participates in the apoptotic response to DNA damage. Isoforms containing the transactivation domain are pro-apoptotic, isoforms lacking the domain are anti-apoptotic and block the function of p53 and transactivating p73 isoforms. May be a tumor
• PDB: 1COK, 1DXS, 2KBY, 2MPS, 2NB1, 2WQI, 2WQJ, 2WTT, 2XWC, 3VD0, 3VD1, 3VD2, 4A63, 4G82, 4G83, 4GUO, 4GUQ, 5HOB, 5HOC, 5KBD, 6FGS, 6IJQ, 7EZJ, 8P9C, 8P9D, 8P9E, 9GLQ, 9GNB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00870	P53	117 → 309	P53 DNA-binding domain	Domain
  PF07710	P53_tetramer	345 → 384	P53 tetramerisation motif	Motif
  PF07647	SAM_2	485 → 549	SAM domain (Sterile alpha motif)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in striatal neurons of patients with Huntington disease (at protein level). Brain, kidney, placenta, colon, heart, liver, spleen, skeletal muscle, prostate, thymus and pancreas. Highly expressed in fetal tissue. Expressed in
• Sequence:

  MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTS
  VMAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTMSPAPVIPSNTD
  YPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPV
  YKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPY
  EPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGR
  DRKADEDHYREQQALNESSAKNGAASKRAFKQSPPAVPALGAGVKKRRHGDEDTYYLQVR
  GRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQRPSHLQPPSYGPVLSPMNKVHGG
  MNKLPSVNQLVGQPPPHSSAATPNLGPVGPGMLNNHGHAVPANGEMSSSHSAQSMVSGSH
  CTPPPPYHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMT
  IWRGLQDLKQGHDYSTAQQLLRSSNAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRG
  GPGGGPDEWADFGFDLPDCKARKQPIKEEFTEAEIH

• Sequence length: 636

Pathways

KEGG:

p53 signaling pathway
Hippo signaling pathway
Neurotrophin signaling pathway
Measles

Reactome:

Activation of PUMA and translocation to mitochondria
TP53 Regulates Transcription of Genes Involved in Cytochrome C Release
TP53 regulates transcription of several additional cell death genes whose specific roles in p53-dependent apoptosis remain uncertain
TP53 Regulates Transcription of Caspase Activators and Caspases
TP53 Regulates Transcription of Death Receptors and Ligands
Regulation of TP53 Activity through Association with Co-factors
RUNX1 regulates transcription of genes involved in differentiation of HSCs

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Ciliary dyskinesia, primary, 47, and lissencephaly	Pathogenic	rs2124533497, rs2124524068, rs2124544212, rs2124478772	RCV001553811 RCV001553812 RCV001553813 RCV001553814	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Colon adenocarcinoma	Pathogenic	rs2124533497	RCV005916225	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Respiratory failure	Pathogenic	rs2124478772	RCV001844300	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CILIARY MOTILITY DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL NEUROLOGIC ANOMALIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA-LYMPHOMA, ADULT T-CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental disorder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHABDOMYOSARCOMA, ALVEOLAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMALL CELL LUNG CANCER	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TP73-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acromegaly	Acromegaly	BEFREE	31828584		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	11002429		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10416592, 10419905, 11337015, 15649410, 16541141, 16791269, 20807569		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	15385938, 28978663		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10467409, 10471526, 12560466, 15374945		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12782576		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	11720435		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	12865464		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	19947923, 20862736, 24186203		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10962441, 11301342, 16290057, 17216555		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10419905, 11337015, 15649410, 16541141		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	12966346		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	14688019, 17626635, 17912537, 28971956, 31819485		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	9721206		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	CTD_human_DG	26437031		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	CTD_human_DG	21245298		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	14720173, 15175114	Associate	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	15752257		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	28025428	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	18951500		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	35020242	Associate	★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	19876867, 20844987		★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	33168930	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28822057		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28822057		★☆☆☆☆ Found in Text Mining only
Aqueductal Stenosis	Aqueductal Stenosis	BEFREE	28931858		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	11602183		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11494043, 12200621, 15138575, 17016577		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	15367334, 19876867, 26309132, 34121368	Associate	★☆☆☆☆ Found in Text Mining only
ATAXIA-OCULOMOTOR APRAXIA 3	Ataxia-Oculomotor Apraxia	BEFREE	17224243		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	11602183		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	34103010	Associate	★☆☆☆☆ Found in Text Mining only
ATRICHIA WITH PAPULAR LESIONS	Atrichia With Papular Lesions	BEFREE	28978663		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	12353228, 20484818, 25915849, 30429221		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	11521806		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	11720435	Associate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	15492805		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	10102633, 10383132, 15292937, 24213852		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	14654547, 15492852		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	10485463		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	11461077		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	11461077, 19585505, 21717430, 23508638, 28239803	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10343122, 10371354, 10397274, 11079155, 11103943, 11319797, 11510689, 12007564, 12066200, 14634508, 15450420, 15849742, 16950799, 20842728, 21933556, 22535334, 23418309, 23443851, 25071010, 26586573, 28258440, 28693277, 29845295, 31850263		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	28212736		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10648616, 17446929, 21214929, 22952705, 25134538, 26452468, 28071670, 31652459, 32092817, 35250881	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	10416592, 11002429		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10408409, 10408709, 11115495, 12427762, 12584188, 15734740, 16980297, 18988287, 20676143, 21245298, 22751441, 23510689, 24404147, 25514460, 26182360, 27516190, 29474580, 31852961, 35625534, 36618305, 9288759	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10383132, 10393724, 11445838, 12241107, 15752257, 16290057, 17385050, 20081800, 23996743, 24213852		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	16413463	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	22925694	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10408709, 20364114, 23065572, 24052075, 24377595, 25032846, 28350813, 28403886, 30942456, 31210297, 31429776, 31652459, 31852961	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	10732753	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	10102633, 10383132, 15292937, 24213852		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10362363, 10408409, 10862041, 11429704, 12901798, 15466174, 15578704, 16434604, 17136456, 19148480, 20528922, 22228141, 24943681, 25910231, 28212736, 29452959, 9622072		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	40244040	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	30016766, 31652459	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	16413471, 18988287, 27246533	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28679648	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	31332036	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10509157, 10773878, 11051237, 16322298, 18039564, 19509552, 23095717, 28915954		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	15036661, 15161684, 21711160, 22729911, 28128397, 28915681, 30420492, 30963795, 31332036		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	15036661, 15066318, 21711160, 22729911, 28128397, 28915681, 30420492, 30963795, 31332036		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10419905, 11337015, 15649410, 16541141		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	14688019, 17626635, 17912537, 28971956, 31819485		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	9721206		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	10362118, 15467712		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	10362118, 15467712, 20422343, 31652459	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	28551631		★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	18556456, 33168930	Associate	★☆☆☆☆ Found in Text Mining only
Chromosome 1p36 Deletion Syndrome	Chromosome 1p36 deletion syndrome	Pubtator	24252393	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11521806, 19096009, 19541822, 20882050, 21048031		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	21107580		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	14719122		★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	20364114	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	30604274	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21807636, 31025168		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	19106635, 26294215, 39300412	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11571580, 11675903, 12865464, 14732927, 15485994, 15526363, 17029218, 17044134, 19016816, 19581013, 19956069, 20644956, 20733477, 20845513, 26294215, 26759239, 27654017, 31090204, 9664127		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	11675903, 18546269		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11675903, 20845513, 26294215, 29945573, 31537884, 31652459	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27654017, 30700826	Inhibit	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	20844987, 22962577		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	18714155, 23404110		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15385938, 9796703		★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma Protuberans	Dermatofibrosarcoma Protuberans	BEFREE	9808434		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	34681648	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33902539	Associate	★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	14522906		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	16670073, 17454594		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	22751441, 23089923		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	22751441	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	15723718		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	16928264	Associate	★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	10213163, 12241107, 12850376		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	17047653		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	19509552		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	11720435, 20922573, 21573788, 24820515, 31474710		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	12841870		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	12841870, 24820515, 31474710	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	20922573, 21573788, 24820515, 31474710, 9797131		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	11720435, 17761206, 24820515, 31474710, 31652459	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	16087177		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	LHGDN	16087177		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	16087177	Associate	★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	16087177		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	35020242	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	24127039		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	12560466	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	15374945		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	31852961	Associate	★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	11786399, 12823347	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	25532599		★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	9808434		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11494043, 12200621, 19876867, 20844987, 27671304, 30213795, 31763674		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19876867, 24709822, 26930720, 28168356, 30867410, 34115613, 34238116, 36674747	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11494043, 12200621, 19876867, 27671304, 30213795, 31763674		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	12241107, 20844987, 30127981		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	17047653, 31652459, 33028341, 33589576, 34121368	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	22469882		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	19426493		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	15572378, 19426493, 22170762	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	10416592, 11002429, 15649410, 15849769, 16541141, 22497596		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	10400412, 10485463		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	23065572	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	12353228, 12966346, 15475076, 16541141		★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	28931858		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30604274		★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	11103943		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35039758	Associate	★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	15390192		★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	37081063	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	31562358		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10419905, 10485463, 24872081		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10419905, 12427762, 15015578, 15031205, 18556456, 18565851, 22412883, 22971533, 35787399	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	16741250, 19111660		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10419905, 15849769, 16467208, 20671427, 20675383	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10400412, 10419905, 11550287, 15385938, 15495254, 15609309, 15849769, 16193303, 16541141		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	15849769		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Leukoplakia	Leukoplakia	BEFREE	19204927		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	15390192, 18701437, 19204927, 22052649, 30668428		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10393724, 10408709, 10706549, 10928060, 11526499, 11991598, 12546528, 14719122, 18342333, 19664633, 20233581, 21261729, 22030623, 23065572, 24052075, 25371988, 28350813		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	14719122, 14760085		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	14719122		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	24377595	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	10408409, 12901798, 15958617, 20528922, 25556480, 27878984, 31652459	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	12901798, 15466174, 17013834, 18022156		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	28212736		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	19016816, 31186762		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23095717, 28134496, 28951630	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31332036	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10419905, 10918605, 11461077, 11786399, 12353228, 16083956, 17407586, 20484818, 24314664, 24730526		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	10419905	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	11461077	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	12353228		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	24660851	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	24660851		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	15291355, 21811875, 24730526		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	15291355		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	15291355, 21811875, 24730526		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	15897551		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	16541141		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	19426493		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	27074052		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	17912537		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10343122, 10371354, 10397274, 10634515, 11079155, 11103943, 11510689, 12007564, 12066200, 14634508, 15450420, 15849742, 16950799, 21933556, 22535334, 23418309, 23443851, 25071010, 26586573, 28258440, 28693277, 29845295, 31850263		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	28212736		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	15723718		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	11720435, 12841870, 20922573, 21573788, 24820515, 28258440, 31474710		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	14527906, 24127039		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	18056460		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10362363, 10408409, 10862041, 11429704, 12901798, 15466174, 15578704, 16434604, 17136456, 18022156, 19148480, 20528922, 22228141, 24943681, 25910231, 28212736, 29452959, 9537234, 9622072		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	28212736		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	18701437, 19204927, 22052649, 30668428		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	19197996, 22523600		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10509157, 10760569, 10773878, 11051237, 16322298, 18039564, 21917857, 23095717		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11585734, 20156675, 21681824, 28535906		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10221564, 11536309, 15492805, 21565625, 28415683, 29467540		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11592094, 19386249, 25400764, 25875960, 25954972, 30106095, 30127981, 31549851		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	14522906, 16322335, 21290209		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	10102633, 10383132, 15292937, 24213852		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10203277, 10362363, 10371354, 10404087, 10416592, 10471526, 10618710, 10773878, 10972855, 11510689, 11571580, 11786399, 11859406, 12619104, 12841870, 14522906, 14618632, 14659698, 14732927, 14734228, 15095006, 15280445, 15485994, 15492805, 16601753, 16980297, 17058198, 17287142, 17334395, 17407586, 18289041, 18302944, 18348649, 18406616, 18477895, 18583938, 18593889, 18801697, 19671150, 19754415, 20298673, 20675383, 21289519, 21391908, 21436470, 21502193, 21515338, 21617940, 21672615, 21717430, 21852228, 21903324, 21917857, 21976716, 22011187, 22419114, 23913810, 24186203, 24730526, 25341038, 25400764, 25409149, 25510918, 26586573, 27103208, 27622714, 28212736, 28551631, 28576884, 28915717, 29077094, 29091904, 29230693, 29452959, 30316927, 30420492, 30635889, 30643007, 31090271, 31332036, 31582429		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	11720444		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	15036661, 21711160, 22729911, 28128397, 28915681, 30420492, 30963795, 31332036		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21807636, 30700826, 31025168		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	28212736		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11445838		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15450420, 15849742, 17446929		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	28212736		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	28212736		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	27074052		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	14688019, 17626635, 17912537, 28971956, 31819485		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	LHGDN	17626635, 17912537		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	17626635	Associate	★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	10404074, 9918412		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10404074, 14618632, 16502261, 18056460, 19671150, 22871739, 26554827, 30445206, 9892203, 9918412		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	14618632, 18049450, 18477895		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	15526363, 21861192, 22871739, 25071017, 31462745	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	10213163, 11414472, 11520574, 14734228, 17695396, 28527972		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	11461077, 34354552	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	17695396		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	10732753, 19326371		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	25071017		★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	10023682		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	19727727		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	11720444	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	LHGDN	18701437		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	18701437, 22052649, 29479029	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10602435, 15318245, 19018094, 19423161, 19727727, 24030633		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	15197802, 19018094, 26410378, 27533450, 29295500, 32714991	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10023682		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	23055192, 24225749		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	22971533, 23055192	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	15609309, 16193303		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	LHGDN	15609309		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10485463, 11027640, 28129457, 28257089		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	GWASDB_DG	21211798		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	21269671, 25201258		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	12632081, 24590897		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	33400379	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10023682, 10102633, 10213163, 10218465, 10221564, 10341287, 10362118, 10383132, 10397274, 10400412, 10404074, 10408409, 10416592, 10419905, 10469295, 10471526, 10509157, 10562283, 10601564, 10606650, 10618710, 10634515, 10719054, 10732753, 10760569, 10769197, 10815895, 10830907, 10928060, 10935473, 10953317, 11002429, 11051237, 11205839, 11238924, 11301342, 11319797, 11323391, 11414472, 11461077, 11487055, 11494043, 11510689, 11520574, 11526499, 11595834, 11675903, 11720435, 11839584, 11859406, 11920588, 11957139, 12097259, 12192602, 12241107, 12353228, 12546528, 12560466, 12680226, 12681362, 12800197, 12850376, 12865464, 12897129, 12901798, 14659698, 14719122, 14734228, 15095006, 15138575, 15221786, 15292937, 15467712, 15475076, 15492852, 15495198, 15723718, 15741235, 15897551, 16021638, 16271066, 16380414, 16481734, 16541141, 16636659, 16721041, 17016577, 17018588, 17029218, 17044134, 17047653, 17142102, 17227125, 17347683, 17407586, 17493032, 17496887, 17626635, 17695396, 17700533, 17761206, 18022156, 18234963, 18239687, 18289041, 18302944, 18406616, 18469517, 18546269, 18583938, 18832062, 19148480, 19177004, 19197996, 19237629, 19363520, 19423161, 19664633, 19671150, 19956069, 20054805, 20081800, 20091234, 20160513, 20484818, 20733477, 21048031, 21289519, 21565625, 21573788, 21711160, 21903324, 21933556, 21941372, 22030623, 22200536, 22340593, 22412883, 22497596, 22523600, 22925694, 22951905, 24213852, 24289130, 24314664, 24730526, 25071014, 25510918, 25516466, 25535357, 25556480, 25622532, 25910231, 25915849, 26032560, 26182360, 26184366, 26516139, 26586573, 27091942, 27654017, 27671304, 28350813, 28527972, 28915954, 29222041, 29307398, 29366442, 29467540, 29845295, 30429221, 30635889, 31025168, 31090271, 31173249, 31186762, 31562358, 31850263, 9288759, 9605745, 9622072, 9664127, 9721206, 9797131, 9831242, 9858816, 9892203, 9918412		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	10760569, 15526363, 26184366, 31186762		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	10213163, 11461077		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10023682, 10213163, 10341287, 10383137, 10404087, 10408709, 10601564, 10719054, 10769197, 10935473, 10972855, 11002429, 11205839, 11429704, 11859407, 12192602, 12880969, 14676279, 15385938, 15650242, 15741235, 16773194, 17076661, 17505515, 18583365, 19363520, 20222799, 26633716, 9288759, 9664127, 9721206, 9831242, 9918412		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	10408409	Inhibit	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	10408709, 10732753, 10935473, 12192602, 18583365, 9288759	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	LHGDN	15741235		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	34115613	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	15255999	Associate	★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	12632081		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11454718, 12875622, 19148480, 21289519, 21841506, 25556480, 28134496, 28415779, 28789416, 29452959, 29803931		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28415779		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28415779, 33902539	Associate	★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	10732753, 10953317, 11461077, 12200621, 20844987, 9721206		★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	11461077	Associate	★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	19197996, 22523600		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	19197996, 22523600	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	17568187, 19779497, 30250645		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	19779497, 9802988	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10467409, 10509157, 10760569, 10773878, 10962441, 11051237, 16322298, 18039564, 23095717		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10606650, 11238060, 12928725, 18039564, 18566213, 21516125, 21917857, 23095717, 31652459, 35867729, 40244040	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11585734, 20156675, 21681824, 28535906		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	14511408		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	14511408, 19237629, 21212431, 21681824, 24534469, 30643007, 31652459, 34007135	Associate	★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	11301342		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	BEFREE	11301342		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	12241107		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	31645664		★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	10419905		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	10419905		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	10419905		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	10416592, 15649410, 20807569		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	12133444		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10221564, 11340630, 11536309, 15492805, 21565625, 28415683, 29467540, 9605745		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	15492805		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15492805		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29506519	Associate	★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	18056460		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15385938, 9796703		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	12584188		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	12584188	Inhibit	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	22278416, 31015368	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	21245298		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	21245298	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29383169		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	22389451	Associate	★☆☆☆☆ Found in Text Mining only
SCAPULOPERONEAL MYOPATHY, X-LINKED DOMINANT	Scapuloperoneal Myopathy, X-Linked	BEFREE	21717430		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	ORPHANET_DG	26168399		★☆☆☆☆ Found in Text Mining only
Small cell lung cancer	Lung Cancer	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	10634515		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11323391, 11948487, 11957139, 15390192, 16818688, 17018588, 21293058, 25516466, 27246533, 9537234		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	LHGDN	11788901, 11957139, 15180941, 15390192, 16818688, 17761206		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17617876, 21169275, 21573788, 24820515, 25622532, 31474710		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	16413463, 16413471, 19197996, 19426493, 19585505, 19597475, 20665144, 20729916, 21717430, 23508638, 25374236, 33227411, 35327630, 35756491	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	11788901		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	18988287		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	24417641		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	15180941, 19197996, 19426493, 19585505, 21717430		★☆☆☆☆ Found in Text Mining only
Squamous Cell Neoplasms	Neoplasm	LHGDN	17018588		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11592094, 17058198, 19386249, 25400764, 25875960, 25954972, 30106095, 30127981, 31549851		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12560466, 25875960, 25954972, 30106095, 30212456, 31549851, 31652459, 35073920	Associate	★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	10769197, 12353228		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	14522906, 16322335, 21290209		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	14522906, 16290057, 16322335, 21290209, 31006665		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	18234963		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	18234963, 31006665, 36618305	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	21214929, 22535334, 23443851		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	30604274		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24213852, 31318640, 31652459	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	11870517	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	BEFREE	15066318		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17504382, 17971771, 20644729, 30963795, 31332036, 31663517, 35896897	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34380847	Stimulate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	18477895		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	11602183		★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation, Paroxysmal Familial, 1	Ventricular Fibrillation	BEFREE	21402718		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	19423161, 25803193		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	25803193	Associate	★☆☆☆☆ Found in Text Mining only
Warburg Sjo Fledelius syndrome	Warburg micro syndrome	Pubtator	27807512	Associate	★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	10732753, 10953317, 11461077, 12200621, 20844987, 9721206		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	28930610	Associate	★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP C	Xeroderma Pigmentosum	BEFREE	17510383		★☆☆☆☆ Found in Text Mining only