TP53BP2 (tumor protein p53 binding protein 2)

Gene

• Entrez ID: 7159
• Gene name: Tumor protein p53 binding protein 2
• Gene symbol: TP53BP2
• Synonyms (NCBI Gene): 53BP2, ASPP2, BBP, P53BP2, PPP1R13A
• Chromosome: 1
• Chromosome location: 1q41
• Summary: This gene encodes a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. It is localized to the perinuclear regi

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005328	hsa-miR-21-5p	Luciferase reporter assay, qRT-PCR	18829576
MIRT036878	hsa-miR-877-3p	CLASH	23622248
MIRT036049	hsa-miR-1301-3p	CLASH	23622248
MIRT437684	hsa-miR-222-3p	Microarray, qRT-PCR	22815788
MIRT1448060	hsa-miR-28-3p	CLIP-seq
MIRT1448061	hsa-miR-3160-3p	CLIP-seq
MIRT1448062	hsa-miR-4305	CLIP-seq
MIRT1448063	hsa-miR-4320	CLIP-seq
MIRT1448064	hsa-miR-4436a	CLIP-seq
MIRT1448065	hsa-miR-4699-3p	CLIP-seq
MIRT1448066	hsa-miR-4700-3p	CLIP-seq
MIRT1448067	hsa-miR-578	CLIP-seq
MIRT1448068	hsa-miR-643	CLIP-seq
MIRT1448069	hsa-miR-1207-3p	CLIP-seq
MIRT1448070	hsa-miR-1263	CLIP-seq
MIRT1448071	hsa-miR-1277	CLIP-seq
MIRT1448072	hsa-miR-1283	CLIP-seq
MIRT1448073	hsa-miR-144	CLIP-seq
MIRT1448074	hsa-miR-21	CLIP-seq
MIRT1448075	hsa-miR-2116	CLIP-seq
MIRT1448076	hsa-miR-219-5p	CLIP-seq
MIRT1448060	hsa-miR-28-3p	CLIP-seq
MIRT1448077	hsa-miR-3121-5p	CLIP-seq
MIRT1448078	hsa-miR-3157-5p	CLIP-seq
MIRT1448079	hsa-miR-3189-5p	CLIP-seq
MIRT1448080	hsa-miR-3200-5p	CLIP-seq
MIRT1448081	hsa-miR-370	CLIP-seq
MIRT1448082	hsa-miR-375	CLIP-seq
MIRT1448083	hsa-miR-3924	CLIP-seq
MIRT1448084	hsa-miR-4273	CLIP-seq
MIRT1448085	hsa-miR-4282	CLIP-seq
MIRT1448062	hsa-miR-4305	CLIP-seq
MIRT1448063	hsa-miR-4320	CLIP-seq
MIRT1448086	hsa-miR-4503	CLIP-seq
MIRT1448087	hsa-miR-4677-5p	CLIP-seq
MIRT1448065	hsa-miR-4699-3p	CLIP-seq
MIRT1448088	hsa-miR-4735-5p	CLIP-seq
MIRT1448089	hsa-miR-4758-3p	CLIP-seq
MIRT1448090	hsa-miR-4782-3p	CLIP-seq
MIRT1448067	hsa-miR-578	CLIP-seq
MIRT1448091	hsa-miR-590-5p	CLIP-seq
MIRT1448092	hsa-miR-607	CLIP-seq
MIRT1448093	hsa-miR-628-5p	CLIP-seq
MIRT1448068	hsa-miR-643	CLIP-seq
MIRT2134069	hsa-miR-1207-5p	CLIP-seq
MIRT2134070	hsa-miR-28-5p	CLIP-seq
MIRT2134071	hsa-miR-299-5p	CLIP-seq
MIRT2134072	hsa-miR-3128	CLIP-seq
MIRT2134073	hsa-miR-3139	CLIP-seq
MIRT2134074	hsa-miR-3169	CLIP-seq
MIRT2134075	hsa-miR-421	CLIP-seq
MIRT2134076	hsa-miR-4266	CLIP-seq
MIRT1448064	hsa-miR-4436a	CLIP-seq
MIRT2134077	hsa-miR-4459	CLIP-seq
MIRT2134078	hsa-miR-4515	CLIP-seq
MIRT1448066	hsa-miR-4700-3p	CLIP-seq
MIRT2134079	hsa-miR-4709-5p	CLIP-seq
MIRT2134080	hsa-miR-4720-5p	CLIP-seq
MIRT2134081	hsa-miR-4722-5p	CLIP-seq
MIRT2134082	hsa-miR-4736	CLIP-seq
MIRT2134083	hsa-miR-4763-3p	CLIP-seq
MIRT2134084	hsa-miR-4799-3p	CLIP-seq
MIRT2134085	hsa-miR-570	CLIP-seq
MIRT2134086	hsa-miR-646	CLIP-seq
MIRT2134087	hsa-miR-651	CLIP-seq
MIRT2134088	hsa-miR-708	CLIP-seq
MIRT2355116	hsa-miR-2277-3p	CLIP-seq
MIRT2355117	hsa-miR-3919	CLIP-seq
MIRT2355118	hsa-miR-4501	CLIP-seq
MIRT2355119	hsa-miR-4756-3p	CLIP-seq
MIRT2649029	hsa-miR-300	CLIP-seq
MIRT2649030	hsa-miR-338-5p	CLIP-seq
MIRT2649031	hsa-miR-3614-3p	CLIP-seq
MIRT2649032	hsa-miR-381	CLIP-seq
MIRT2649033	hsa-miR-3944-5p	CLIP-seq
MIRT2649034	hsa-miR-4297	CLIP-seq
MIRT2649035	hsa-miR-4666-3p	CLIP-seq
MIRT2649036	hsa-miR-515-3p	CLIP-seq
MIRT2649037	hsa-miR-519e	CLIP-seq
MIRT2649038	hsa-miR-595	CLIP-seq
MIRT2649039	hsa-miR-648	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
E2F1	Activation	15706352
E2F1	Unknown	19610065
RB1	Unknown	19610065

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002039	Function	P53 binding	IBA
GO:0002039	Function	P53 binding	IEA
GO:0002039	Function	P53 binding	IPI	14985081
GO:0005515	Function	Protein binding	IPI	8875926, 10498867, 10646860, 11278422, 11684014, 12694406, 14729977, 14985081, 15161933, 15231748, 17965023, 18275817, 18448430, 18719108, 19377511, 21513714, 21988832, 21998301, 22321011, 24366813, 24855949, 25344754, 25416956, 25436413, 25502805, 25963096, 26496610, 28330616, 2851
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	19377511
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	10646860, 14985081, 19377511
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9748285, 15782125
GO:0005829	Component	Cytosol	IDA
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	TAS	9748285
GO:0017124	Function	SH3 domain binding	IEA
GO:0030054	Component	Cell junction	IDA
GO:0042802	Function	Identical protein binding	IPI	18448430
GO:0042803	Function	Protein homodimerization activity	IPI	25963096
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0045786	Process	Negative regulation of cell cycle	IEA
GO:0045786	Process	Negative regulation of cell cycle	TAS	14729977
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	10646860
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	14985081
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051059	Function	NF-kappaB binding	IPI	10498867
GO:0072332	Process	Intrinsic apoptotic signaling pathway by p53 class mediator	IDA	11684014
GO:0072332	Process	Intrinsic apoptotic signaling pathway by p53 class mediator	IEA
GO:1900119	Process	Positive regulation of execution phase of apoptosis	IMP	14985081

Other IDs

• MIM: 602143
• HGNC: 12000
• e!Ensembl: ENSG00000143514

Protein

• UniProt ID: Q13625
• Protein name: Apoptosis-stimulating of p53 protein 2 (Bcl2-binding protein) (Bbp) (Renal carcinoma antigen NY-REN-51) (Tumor suppressor p53-binding protein 2) (53BP2) (p53-binding protein 2) (p53BP2)
• Protein function: Regulator that plays a central role in regulation of apoptosis and cell growth via its interactions with proteins such as TP53 (PubMed:12524540). Regulates TP53 by enhancing the DNA binding and transactivation function of TP53 on the promoters o
• PDB: 1YCS, 2UWQ, 4A63, 4IRV, 6GHM, 6HKP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13606	Ank_3	958 → 987	Ankyrin repeat	Repeat
  PF00023	Ank	991 → 1023	Ankyrin repeat	Repeat
  PF00018	SH3_1	1063 → 1111	SH3 domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. Expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocyte. Reduced expression in breast carcinomas expressing a wild-type TP53 protein. Overexpressed in lung cancer ce
• Sequence:

  MMPMFLTVYLSNNEQHFTEVPVTPETICRDVVDLCKEPGESDCHLAEVWCGSERPVADNE
  RMFDVLQRFGSQRNEVRFFLRHERPPGRDIVSGPRSQDPSLKRNGVKVPGEYRRKENGVN
  SPRMDLTLAELQEMASRQQQQIEAQQQLLATKEQRLKFLKQQDQRQQQQVAEQEKLKRLK
  EIAENQEAKLKKVRALKGHVEQKRLSNGKLVEEIEQMNNLFQQKQRELVLAVSKVEELTR
  QLEMLKNGRIDSHHDNQSAVAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKRNSEVAV
  MDKRVNELRDRLWKKKAALQQKENLPVSSDGNLPQQAASAPSRVAAVGPYIQSSTMPRMP
  SRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQTKGSKIHPVGPDWSPSNADL
  FPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQS
  SEDILRDAQVANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSM
  GTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRK
  PQTVAASSIYSMYTQQQAPGKNFQQAVQSALTKTHTRGPHFSSVYGKPVIAAAQNQQQHP
  ENIYSNSQGKPGSPEPETEPVSSVQENHENERIPRPLSPTKLLPFLSNPYRNQSDADLEA
  LRKKLSNAPRPLKKRSSITEPEGPNGPNIQKLLYQRTTIAAMETISVPSYPSKSASVTAS
  SESPVEIQNPYLHVEPEKEVVSLVPESLSPEDVGNASTENSDMPAPSPGLDYEPEGVPDN
  SPNLQNNPEEPNPEAPHVLDVYLEEYPPYPPPPYPSGEPEGPGEDSVSMRPPEITGQVSL
  PPGKRTNLRKTGSERIAHGMRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGI
  TALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFA
  MTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKE
  GDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRIKPRQRSLA

• Sequence length: 1128

Pathways

KEGG:

Hippo signaling pathway

Reactome:

Activation of PUMA and translocation to mitochondria
TP53 Regulates Transcription of Genes Involved in Cytochrome C Release
TP53 regulates transcription of several additional cell death genes whose specific roles in p53-dependent apoptosis remain uncertain
TP53 Regulates Transcription of Death Receptors and Ligands
Regulation of TP53 Activity through Association with Co-factors

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, LOBULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GILLES DE LA TOURETTE SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA, OPEN-ANGLE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	ClinGen	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TP53BP2-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	24312201		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12524540, 26663100, 29568874		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	28650484		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26663100, 28179588, 32420372	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	16098144	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25032846, 25980493, 26934443, 28351301, 31685796	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36752127	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29669316		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	29747775	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	23671128		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25534115, 29731851		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29890207		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	16098144	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	12613517		★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	27378826		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	28103919	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	29747775	Inhibit	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29196956		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	30389910		★☆☆☆☆ Found in Text Mining only
Gestational trophoblastic disease	Hydatidiform mole	BEFREE	31615473		★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Disease	Gestational trophoblastic disease	Pubtator	31615473	Associate	★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Neoplasms	Gestational Trophoblastic Neoplasms	BEFREE	31615473		★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	28150229	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	28150229		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	GENOMICS_ENGLAND_DG	28150229		★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	37858684	Associate	★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	23671128		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	27473084		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30675758		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	29443735		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	24312201		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	24312201, 35780096	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24312201, 30952616	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20034025, 25032846, 25980493, 26934443, 27473084, 27929538, 28902369, 29844830, 30528232, 31685796		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	40311306	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29747775	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	24312201		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	12613517		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26663100, 29568874		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	28650484		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	30389910		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29669316		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15986435, 28400336		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12613517, 26438046, 29731851, 30528232, 8875926		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	28650484		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	27939881, 29568874		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	28650484		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	28650484		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	16098144	Inhibit	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12613517, 20034025, 23671128, 24097901, 24127607, 24312201, 24958857, 25534115, 27437940, 27929538, 27939881, 28179588, 30328798, 30389910, 30528232, 31402222, 31424649, 31535570, 31685796, 31817988		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28392757, 31186708		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22552744		★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	10642520		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	26438046	Inhibit	★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	27378826		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29890207		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	35780096	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	BEFREE	24127607		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28103919, 29747775		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29443735	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15986435, 28400336		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15986435		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	30305342, 32420372	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	29747775	Inhibit	★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	27378826	Associate	★☆☆☆☆ Found in Text Mining only