Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7153
Gene name	DNA topoisomerase II alpha
Gene symbol	TOP2A
Synonyms (NCBI Gene)	TOP2TOP2alphaTOPIIATP2A
Chromosome	17
Chromosome location	17q21.2
Summary	This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional str

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs140672916	C>T	Conflicting-interpretations-of-pathogenicity	Intron variant

229

Show/Hide all (229)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016473	hsa-miR-193b-3p	Microarray	20304954
MIRT030914	hsa-miR-21-5p	Microarray	18591254
MIRT047766	hsa-miR-7-5p	CLASH	23622248
MIRT045191	hsa-miR-186-5p	CLASH	23622248
MIRT037756	hsa-miR-708-5p	CLASH	23622248
MIRT036474	hsa-miR-1226-3p	CLASH	23622248
MIRT690907	hsa-miR-561-3p	HITS-CLIP	23313552
MIRT690906	hsa-miR-495-3p	HITS-CLIP	23313552
MIRT690905	hsa-miR-5688	HITS-CLIP	23313552
MIRT690904	hsa-miR-7-1-3p	HITS-CLIP	23313552
MIRT690903	hsa-miR-7-2-3p	HITS-CLIP	23313552
MIRT690902	hsa-miR-4524b-3p	HITS-CLIP	23313552
MIRT690901	hsa-miR-3668	HITS-CLIP	23313552
MIRT690900	hsa-miR-520d-5p	HITS-CLIP	23313552
MIRT690899	hsa-miR-524-5p	HITS-CLIP	23313552
MIRT690898	hsa-miR-203a-3p	HITS-CLIP	23313552
MIRT439403	ebv-miR-BART10-3p	HITS-CLIP	22473208
MIRT439402	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439403	ebv-miR-BART10-3p	HITS-CLIP	22473208
MIRT439402	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT690907	hsa-miR-561-3p	HITS-CLIP	23313552
MIRT690906	hsa-miR-495-3p	HITS-CLIP	23313552
MIRT690905	hsa-miR-5688	HITS-CLIP	23313552
MIRT690904	hsa-miR-7-1-3p	HITS-CLIP	23313552
MIRT690903	hsa-miR-7-2-3p	HITS-CLIP	23313552
MIRT690902	hsa-miR-4524b-3p	HITS-CLIP	23313552
MIRT690901	hsa-miR-3668	HITS-CLIP	23313552
MIRT690900	hsa-miR-520d-5p	HITS-CLIP	23313552
MIRT690899	hsa-miR-524-5p	HITS-CLIP	23313552
MIRT690898	hsa-miR-203a-3p	HITS-CLIP	23313552
MIRT755819	miR-139-5p	Luciferase reporter assayWestern blottingMicroarrayqRT-PCRImmunoprecipitaion (IP)Immunohistochemistry (IHC)ChIP-seq	38008711
MIRT756018	hsa-miR-30c-2-3p	Luciferase reporter assayWestern blottingqRT-PCRImmunohistochemistry (IHC)	37818158
MIRT1447187	hsa-miR-1253	CLIP-seq
MIRT1447188	hsa-miR-1271	CLIP-seq
MIRT1447189	hsa-miR-1273f	CLIP-seq
MIRT1447190	hsa-miR-1323	CLIP-seq
MIRT1447191	hsa-miR-139-5p	CLIP-seq
MIRT1447192	hsa-miR-143	CLIP-seq
MIRT1447193	hsa-miR-144	CLIP-seq
MIRT1447194	hsa-miR-1587	CLIP-seq
MIRT1447195	hsa-miR-186	CLIP-seq
MIRT1447196	hsa-miR-224	CLIP-seq
MIRT1447197	hsa-miR-2355-5p	CLIP-seq
MIRT1447198	hsa-miR-2964a-5p	CLIP-seq
MIRT1447199	hsa-miR-3117-5p	CLIP-seq
MIRT1447200	hsa-miR-3133	CLIP-seq
MIRT1447201	hsa-miR-3143	CLIP-seq
MIRT1447202	hsa-miR-3161	CLIP-seq
MIRT1447203	hsa-miR-3163	CLIP-seq
MIRT1447204	hsa-miR-3173-3p	CLIP-seq
MIRT1447205	hsa-miR-323-3p	CLIP-seq
MIRT1447206	hsa-miR-330-3p	CLIP-seq
MIRT1447207	hsa-miR-340	CLIP-seq
MIRT1447208	hsa-miR-3614-5p	CLIP-seq
MIRT1447209	hsa-miR-365	CLIP-seq
MIRT1447210	hsa-miR-3659	CLIP-seq
MIRT1447211	hsa-miR-3673	CLIP-seq
MIRT1447212	hsa-miR-3682-5p	CLIP-seq
MIRT1447213	hsa-miR-371b-5p	CLIP-seq
MIRT1447214	hsa-miR-377	CLIP-seq
MIRT1447215	hsa-miR-3919	CLIP-seq
MIRT1447216	hsa-miR-3929	CLIP-seq
MIRT1447217	hsa-miR-410	CLIP-seq
MIRT1447218	hsa-miR-411	CLIP-seq
MIRT1447219	hsa-miR-4257	CLIP-seq
MIRT1447220	hsa-miR-4280	CLIP-seq
MIRT1447221	hsa-miR-431	CLIP-seq
MIRT1447222	hsa-miR-4419b	CLIP-seq
MIRT1447223	hsa-miR-4478	CLIP-seq
MIRT1447224	hsa-miR-4511	CLIP-seq
MIRT1447225	hsa-miR-4641	CLIP-seq
MIRT1447226	hsa-miR-4645-3p	CLIP-seq
MIRT1447227	hsa-miR-4658	CLIP-seq
MIRT1447228	hsa-miR-4662a-3p	CLIP-seq
MIRT1447229	hsa-miR-4670-3p	CLIP-seq
MIRT1447230	hsa-miR-4674	CLIP-seq
MIRT1447231	hsa-miR-4699-3p	CLIP-seq
MIRT1447232	hsa-miR-4708-5p	CLIP-seq
MIRT1447233	hsa-miR-4724-5p	CLIP-seq
MIRT1447234	hsa-miR-4744	CLIP-seq
MIRT1447235	hsa-miR-4766-5p	CLIP-seq
MIRT1447236	hsa-miR-4770	CLIP-seq
MIRT1447237	hsa-miR-4771	CLIP-seq
MIRT1447238	hsa-miR-4789-3p	CLIP-seq
MIRT1447239	hsa-miR-485-5p	CLIP-seq
MIRT1447240	hsa-miR-543	CLIP-seq
MIRT1447241	hsa-miR-548a-5p	CLIP-seq
MIRT1447242	hsa-miR-548aa	CLIP-seq
MIRT1447243	hsa-miR-548ab	CLIP-seq
MIRT1447244	hsa-miR-548ac	CLIP-seq
MIRT1447245	hsa-miR-548ae	CLIP-seq
MIRT1447246	hsa-miR-548aj	CLIP-seq
MIRT1447247	hsa-miR-548ak	CLIP-seq
MIRT1447248	hsa-miR-548am	CLIP-seq
MIRT1447249	hsa-miR-548b-5p	CLIP-seq
MIRT1447250	hsa-miR-548c-3p	CLIP-seq
MIRT1447251	hsa-miR-548c-5p	CLIP-seq
MIRT1447252	hsa-miR-548d-3p	CLIP-seq
MIRT1447253	hsa-miR-548d-5p	CLIP-seq
MIRT1447254	hsa-miR-548h	CLIP-seq
MIRT1447255	hsa-miR-548i	CLIP-seq
MIRT1447256	hsa-miR-548j	CLIP-seq
MIRT1447257	hsa-miR-548k	CLIP-seq
MIRT1447258	hsa-miR-548l	CLIP-seq
MIRT1447259	hsa-miR-548o	CLIP-seq
MIRT1447260	hsa-miR-548w	CLIP-seq
MIRT1447261	hsa-miR-548x	CLIP-seq
MIRT1447262	hsa-miR-548y	CLIP-seq
MIRT1447263	hsa-miR-548z	CLIP-seq
MIRT1447264	hsa-miR-559	CLIP-seq
MIRT1447265	hsa-miR-570	CLIP-seq
MIRT1447266	hsa-miR-574-5p	CLIP-seq
MIRT1447267	hsa-miR-582-5p	CLIP-seq
MIRT1447268	hsa-miR-635	CLIP-seq
MIRT1447269	hsa-miR-643	CLIP-seq
MIRT1447270	hsa-miR-888	CLIP-seq
MIRT1447271	hsa-miR-96	CLIP-seq
MIRT2133700	hsa-miR-1193	CLIP-seq
MIRT2133701	hsa-miR-1245	CLIP-seq
MIRT1447188	hsa-miR-1271	CLIP-seq
MIRT1447194	hsa-miR-1587	CLIP-seq
MIRT1447195	hsa-miR-186	CLIP-seq
MIRT2133702	hsa-miR-1910	CLIP-seq
MIRT2133703	hsa-miR-21	CLIP-seq
MIRT1447196	hsa-miR-224	CLIP-seq
MIRT2133704	hsa-miR-2276	CLIP-seq
MIRT2133705	hsa-miR-28-3p	CLIP-seq
MIRT1447200	hsa-miR-3133	CLIP-seq
MIRT1447201	hsa-miR-3143	CLIP-seq
MIRT2133706	hsa-miR-3182	CLIP-seq
MIRT1447205	hsa-miR-323-3p	CLIP-seq
MIRT2133707	hsa-miR-3616-5p	CLIP-seq
MIRT2133708	hsa-miR-3647-5p	CLIP-seq
MIRT1447210	hsa-miR-3659	CLIP-seq
MIRT2133709	hsa-miR-3681	CLIP-seq
MIRT2133710	hsa-miR-3691-5p	CLIP-seq
MIRT1447214	hsa-miR-377	CLIP-seq
MIRT2133711	hsa-miR-3909	CLIP-seq
MIRT1447216	hsa-miR-3929	CLIP-seq
MIRT2133712	hsa-miR-409-3p	CLIP-seq
MIRT1447217	hsa-miR-410	CLIP-seq
MIRT1447218	hsa-miR-411	CLIP-seq
MIRT1447220	hsa-miR-4280	CLIP-seq
MIRT1447222	hsa-miR-4419b	CLIP-seq
MIRT2133713	hsa-miR-4460	CLIP-seq
MIRT1447223	hsa-miR-4478	CLIP-seq
MIRT2133714	hsa-miR-4646-3p	CLIP-seq
MIRT1447227	hsa-miR-4658	CLIP-seq
MIRT1447228	hsa-miR-4662a-3p	CLIP-seq
MIRT1447229	hsa-miR-4670-3p	CLIP-seq
MIRT1447230	hsa-miR-4674	CLIP-seq
MIRT2133715	hsa-miR-4727-3p	CLIP-seq
MIRT2133716	hsa-miR-4753-3p	CLIP-seq
MIRT2133717	hsa-miR-4768-5p	CLIP-seq
MIRT2133718	hsa-miR-4772-3p	CLIP-seq
MIRT1447238	hsa-miR-4789-3p	CLIP-seq
MIRT2133719	hsa-miR-4795-5p	CLIP-seq
MIRT1447239	hsa-miR-485-5p	CLIP-seq
MIRT1447240	hsa-miR-543	CLIP-seq
MIRT2133720	hsa-miR-544	CLIP-seq
MIRT1447242	hsa-miR-548aa	CLIP-seq
MIRT1447245	hsa-miR-548ae	CLIP-seq
MIRT1447246	hsa-miR-548aj	CLIP-seq
MIRT1447248	hsa-miR-548am	CLIP-seq
MIRT1447261	hsa-miR-548x	CLIP-seq
MIRT2133721	hsa-miR-573	CLIP-seq
MIRT1447266	hsa-miR-574-5p	CLIP-seq
MIRT2133722	hsa-miR-590-5p	CLIP-seq
MIRT2133723	hsa-miR-603	CLIP-seq
MIRT1447268	hsa-miR-635	CLIP-seq
MIRT1447270	hsa-miR-888	CLIP-seq
MIRT2133724	hsa-miR-9	CLIP-seq
MIRT2133725	hsa-miR-924	CLIP-seq
MIRT1447271	hsa-miR-96	CLIP-seq
MIRT2354862	hsa-miR-105	CLIP-seq
MIRT2354863	hsa-miR-1298	CLIP-seq
MIRT1447193	hsa-miR-144	CLIP-seq
MIRT1447194	hsa-miR-1587	CLIP-seq
MIRT2354864	hsa-miR-1827	CLIP-seq
MIRT1447195	hsa-miR-186	CLIP-seq
MIRT1447198	hsa-miR-2964a-5p	CLIP-seq
MIRT1447200	hsa-miR-3133	CLIP-seq
MIRT1447201	hsa-miR-3143	CLIP-seq
MIRT1447203	hsa-miR-3163	CLIP-seq
MIRT1447207	hsa-miR-340	CLIP-seq
MIRT2354865	hsa-miR-34b	CLIP-seq
MIRT1447208	hsa-miR-3614-5p	CLIP-seq
MIRT1447210	hsa-miR-3659	CLIP-seq
MIRT1447212	hsa-miR-3682-5p	CLIP-seq
MIRT1447216	hsa-miR-3929	CLIP-seq
MIRT2133712	hsa-miR-409-3p	CLIP-seq
MIRT1447218	hsa-miR-411	CLIP-seq
MIRT1447219	hsa-miR-4257	CLIP-seq
MIRT1447220	hsa-miR-4280	CLIP-seq
MIRT1447221	hsa-miR-431	CLIP-seq
MIRT1447222	hsa-miR-4419b	CLIP-seq
MIRT1447223	hsa-miR-4478	CLIP-seq
MIRT1447226	hsa-miR-4645-3p	CLIP-seq
MIRT1447227	hsa-miR-4658	CLIP-seq
MIRT2354866	hsa-miR-4659a-3p	CLIP-seq
MIRT2354867	hsa-miR-4659b-3p	CLIP-seq
MIRT1447229	hsa-miR-4670-3p	CLIP-seq
MIRT1447230	hsa-miR-4674	CLIP-seq
MIRT2354868	hsa-miR-4735-5p	CLIP-seq
MIRT1447234	hsa-miR-4744	CLIP-seq
MIRT2354869	hsa-miR-4775	CLIP-seq
MIRT1447239	hsa-miR-485-5p	CLIP-seq
MIRT1447240	hsa-miR-543	CLIP-seq
MIRT1447242	hsa-miR-548aa	CLIP-seq
MIRT1447266	hsa-miR-574-5p	CLIP-seq
MIRT2354870	hsa-miR-590-3p	CLIP-seq
MIRT2354871	hsa-miR-606	CLIP-seq
MIRT1447268	hsa-miR-635	CLIP-seq
MIRT1447269	hsa-miR-643	CLIP-seq
MIRT1447210	hsa-miR-3659	CLIP-seq
MIRT1447216	hsa-miR-3929	CLIP-seq
MIRT1447218	hsa-miR-411	CLIP-seq
MIRT1447219	hsa-miR-4257	CLIP-seq
MIRT1447220	hsa-miR-4280	CLIP-seq
MIRT1447222	hsa-miR-4419b	CLIP-seq
MIRT1447223	hsa-miR-4478	CLIP-seq
MIRT2396208	hsa-miR-4502	CLIP-seq
MIRT1447227	hsa-miR-4658	CLIP-seq
MIRT1447239	hsa-miR-485-5p	CLIP-seq
MIRT1447266	hsa-miR-574-5p	CLIP-seq
MIRT1447268	hsa-miR-635	CLIP-seq
MIRT1447187	hsa-miR-1253	CLIP-seq
MIRT2462139	hsa-miR-3185	CLIP-seq
MIRT2462140	hsa-miR-580	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
ATF1	Unknown	12104051
E2F1	Activation	11313881
UHRF1	Unknown	10646863
YBX1	Unknown	10597187

Show/Hide all (63)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000228	Component	Nuclear chromosome	IDA	9049244
GO:0000287	Function	Magnesium ion binding	IDA	22323612
GO:0000712	Process	Resolution of meiotic recombination intermediates	IBA
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000793	Component	Condensed chromosome	IEA
GO:0000819	Process	Sister chromatid segregation	IBA
GO:0001673	Component	Male germ cell nucleus	IEA
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IEA
GO:0003677	Function	DNA binding	IDA	9049244, 10788521, 12079377
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IDA	9049244
GO:0003682	Function	Chromatin binding	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003916	Function	DNA topoisomerase activity	IEA
GO:0003918	Function	DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity	IBA
GO:0003918	Function	DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity	IDA	15491148, 16611985
GO:0003918	Function	DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity	IEA
GO:0003918	Function	DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity	IMP	12711669
GO:0005080	Function	Protein kinase C binding	IPI	16611985
GO:0005515	Function	Protein binding	IPI	10666337, 10788521, 10959840, 11062478, 11136718, 12711669, 15965487, 16611985, 17567603, 17983804, 18790802, 19390626, 20457750, 23213405, 23652018, 23698369, 26030138, 36271492
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9155056, 10788521, 10959840, 16611985
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	8299728, 9049244
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA	9049244
GO:0005730	Component	Nucleolus	IDA	8299728, 9155056, 17567603
GO:0005737	Component	Cytoplasm	IDA	9155056
GO:0005737	Component	Cytoplasm	IEA
GO:0005814	Component	Centriole	IDA	9049244
GO:0006259	Process	DNA metabolic process	IEA
GO:0006265	Process	DNA topological change	IDA	22323612
GO:0006265	Process	DNA topological change	IEA
GO:0006265	Process	DNA topological change	IEA
GO:0006325	Process	Chromatin organization	IMP	12711669
GO:0006974	Process	DNA damage response	IDA	16611985
GO:0007059	Process	Chromosome segregation	IEA
GO:0007059	Process	Chromosome segregation	IMP	11136718, 15456904, 15965487
GO:0007143	Process	Female meiotic nuclear division	IEA
GO:0008094	Function	ATP-dependent activity, acting on DNA	IDA	12079377
GO:0008301	Function	DNA binding, bending	IDA	22323612
GO:0009330	Component	DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) complex	IDA	10473615
GO:0016853	Function	Isomerase activity	IEA
GO:0030261	Process	Chromosome condensation	IEA
GO:0030263	Process	Apoptotic chromosome condensation	IBA
GO:0030263	Process	Apoptotic chromosome condensation	IDA	10959840
GO:0032991	Component	Protein-containing complex	IDA	16611985
GO:0040016	Process	Embryonic cleavage	IEA
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0042803	Function	Protein homodimerization activity	IPI	10473615
GO:0043065	Process	Positive regulation of apoptotic process	IDA	16611985
GO:0043130	Function	Ubiquitin binding	IMP	15965487
GO:0045870	Process	Positive regulation of single stranded viral RNA replication via double stranded DNA intermediate	IEA
GO:0045870	Process	Positive regulation of single stranded viral RNA replication via double stranded DNA intermediate	IMP	16712776
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046982	Function	Protein heterodimerization activity	IPI	10473615
GO:0048511	Process	Rhythmic process	IEA
GO:1990904	Component	Ribonucleoprotein complex	IDA	12711669

MIM	HGNC	e!Ensembl
126430	11989	ENSG00000131747

P11388

Protein name

DNA topoisomerase 2-alpha (EC 5.6.2.2) (DNA topoisomerase II, alpha isozyme)

Protein function

Key decatenating enzyme that alters DNA topology by binding to two double-stranded DNA molecules, generating a double-stranded break in one of the strands, passing the intact strand through the broken strand, and religating the broken strand (Pu

PDB

1ZXM , 1ZXN , 4FM9 , 4R1F , 5GWK , 5NNE , 6ZY5 , 6ZY6 , 6ZY7 , 6ZY8 , 8W50

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02518	HATPase_c	76 → 225	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase	Domain
PF00204	DNA_gyraseB	266 → 430	DNA gyrase B	Domain
PF01751	Toprim	456 → 572	Toprim domain	Family
PF16898	TOPRIM_C	573 → 711	C-terminal associated domain of TOPRIM	Family
PF00521	DNA_topoisoIV	713 → 1172	DNA gyrase/topoisomerase IV, subunit A	Family
PF08070	DTHCT	1430 → 1522	DTHCT (NUC029) region	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in the tonsil, spleen, lymph node, thymus, skin, pancreas, testis, colon, kidney, liver, brain and lung (PubMed:9155056). Also found in high-grade lymphomas, squamous cell lung tumors and seminomas (PubMed:9155056). {ECO:0000

Sequence

MEVSPLQPVNENMQVNKIKKNEDAKKRLSVERIYQKKTQLEHILLRPDTYIGSVELVTQQ
MWVYDEDVGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWN
NGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVE
TASREYKKMFKQTWMDNMGRAGEMELKPFNGEDYTCITFQPDLSKFKMQSLDKDIVALMV
RRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKLDETGNSLKVIHEQVNHRWEVC
LTMSEKGFQQISFVNSIATSKGGRHVDYVADQIVTKLVDVVKKKNKGGVAVKAHQVKNHM
WIFVNALIENPTFDSQTKENMTLQPKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQ
VQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSTECTLILTEGDSAKTLAVSGLGVVGRDK
YGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMT
DQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEMAFYSLPEFEEWKS
STPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQIDD
RKEWLTNFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVD
GLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNN
LNLLQPIGQFGTRLHGGKDSASPRYIFTMLSSLARLLFPPKDDHTLKFLYDDNQRVEPEW
YIPIIPMVLINGAEGIGTGWSCKIPNFDVREIVNNIRRLMDGEEPLPMLPSYKNFKGTIE
ELAPNQYVISGEVAILNSTTIEISELPVRTWTQTYKEQVLEPMLNGTEKTPPLITDYREY
HTDTTVKFVVKMTEEKLAEAERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILR
DFFELRLKYYGLRKEWLLGMLGAESAKLNNQARFILEKIDGKIIIENKPKKELIKVLIQR
GYDSDPVKAWKEAQQKVPDEEENEESDNEKETEKSDSVTDSGPTFNYLLDMPLWYLTKEK
KDELCRLRNEKEQELDTLKRKSPSDLWKEDLATFIEELEAVEAKEKQDEQVGLPGKGGKA
KGKKTQMAEVLPSPRGQRVIPRITIEMKAEAEKKNKKKIKNENTEGSPQEDGVELEGLKQ
RLEKKQKREPGTKTKKQTTLAFKPIKKGKKRNPWSDSESDRSSDESNFDVPPRETEPRRA
ATKTKFTMDLDSDEDFSDFDEKTDDEDFVPSDASPPKTKTSPKLSNKELKPQKSVVSDLE
ADDVKGSVPLSSSPPATHFPDETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKG
TKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHM
DFDSAVAPRAKSVRAKKPIKYLEESDEDDLF

Sequence length

1531

Interactions

View interactions

	KEGG		Reactome
	Platinum drug resistance		Transcription of E2F targets under negative control by DREAM complex SUMOylation of DNA replication proteins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (20)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Adrenocortical carcinoma, hereditary	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, ADENOID CYSTIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dna topoisomerase II, resistance to inhibition of, by amsacrine	protective	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Long QT syndrome	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SALIVARY GLAND NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOP2A-related disorder	Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (265)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acromegaly	Acromegaly	Pubtator	25692206	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	23163762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	21493871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	17949785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	19949890, 28355294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	27602772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	15762277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	CTD_human_DG	16762588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	23533247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	CTD_human_DG	23533247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	23533247, 28432084, 32147961, 32373071, 35185794, 38053725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21493871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	29869738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	23533247, 28432084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anal carcinoma	Anal Cancer	BEFREE	28454340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	28214203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	20368985, 21595939, 32057913, 8669491	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28815403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	39358545	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	31721906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	23533247, 28432084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	12937144, 23737970, 30520434, 32647207, 33642282, 36115056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	22102081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	23163762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	23163762, 2836804	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	20557373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	18522746, 22203181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	17363613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	14566826, 29581849, 31289523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	14566826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blindness	Blindness	Pubtator	15510606	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	29923182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10469452, 14632728, 14978790, 15034864, 15068318, 15628907, 15891995, 16234514, 16682728, 16864174, 17013533, 17088909, 17453369, 17922046, 18332872 View all (53 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	11583189, 12006526, 16234514, 22204715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10702400, 10854209, 11304576, 11583189, 15628907, 15887027, 15987433, 16097435, 17511886, 17922046, 18332872, 18413646, 18702822, 19176392, 19401546 View all (61 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	23201559	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms Male	Male breast neoplasms	Pubtator	24080492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	2163884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12001123, 30672125, 33765507, 35058360, 35394699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29651323	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	16033110	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	22083232, 23897556, 28755093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	19250538, 31914060, 37861550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	34856000	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	16097435, 20069504, 7745115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	12237772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15765123, 36299605	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22539975, 25695068, 26722553, 29658607, 29843214, 29977454, 30341252, 30702595, 31043166, 31811111, 31822116, 32627011, 32685486, 32722976, 33157984 View all (21 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	34453496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	19539329	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	14566826, 29581849, 31289523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10699927, 18078328, 26386574, 28231233, 31816603, 31839396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	25846551, 27315793	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	36799490	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	21461646, 24388441, 28260099, 31422942, 32986937, 34606125, 34872567, 35778520, 35896362, 9393588	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	18520795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	12001123, 24135250	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	29578153, 36352434, 37985446	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26100858, 27315793, 30760286, 31729978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	32114514	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	12646941, 21493871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	29869738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	31545466, 32040444, 32344256	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	37114547	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28736844, 29761838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	11862483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10597187, 19111388, 24138107, 25777966, 28072746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11862483, 16882699, 19083133, 24752576, 25333365, 25550888, 25746763, 25777966, 26040697, 26867764, 26947016, 28072746, 28816939, 31072339, 31137244 View all (4 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17983804, 19111388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29651323	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital contractural arachnodactyly	Pubtator	32344256	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28069330, 31505165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	LHGDN	17410335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	22998676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	25815791	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30302721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	25931012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	21856934	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	16803541, 32555395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	26100858, 30760286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32443386	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibromatosis	Fibromatosis	BEFREE	22203181		★★★★★ ★☆☆☆☆ Found in Text Mining only
gallbladder neoplasm	Neoplasm of gallbladder	LHGDN	18824850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	18204862, 28728050, 32925281	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	16949920, 19061514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	26952515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	33266502	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	12937144, 15494095, 21904904, 23737970, 32647207, 39528802, 8172796	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22102081, 22569122, 29988316, 30544723, 31119182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22102081, 22569122, 29988316, 30544723, 31119182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	10344108, 23736022, 28106765, 33537815, 33765507, 33892537, 35012441, 37901992, 9330528	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	LHGDN	15809708		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	CTD_human_DG	18402387		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	22102081, 28368417, 30544723, 31583565		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	Pubtator	11012894	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	38301615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	11012894	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	12646941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IIb	Glycogen storage disease	Pubtator	18520795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	32603365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	25205790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	22900064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematuria	Hematuria	Pubtator	26981592	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	29587760, 33376723	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	25695068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	18347177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	10971522	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	22203181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	10971522	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	24658003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	19019771		★★★★★ ★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	26994023		★★★★★ ★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	26994023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma of uterus	Leiomyosarcoma Of Uterus	BEFREE	26994023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	31346236		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	CTD_human_DG	15833037		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia	Leukemia	Pubtator	16357944, 17332311, 23041231, 23163762, 25140305, 26163765, 28385713, 7756657, 8634439, 8639880, 8948668, 9808573	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leukemia	Leukemia	BEFREE	22900064, 28385713, 31614754, 31775111, 9494516		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia Myeloid	Myeloid leukemia	Pubtator	9633900, 9763573	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	17332311, 19127593, 19458360, 19530238, 22615413, 23163762, 24327541, 25786458, 31138411, 32218491, 34405474, 35807446, 7904487, 8260707, 8948668, 9226152, 9808573 View all (2 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	10203104, 15829534, 19884644, 29447373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11425459, 22627319, 27974636, 31271486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	26994023		★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	LHGDN	14989736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	18820673, 21335544, 22300273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19003983, 22539975, 24103454, 25695068, 28599412, 31103408, 31771612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	37861550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	30132517		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	10879730, 29578153, 31816603, 32831194, 35178291, 39331864, 9765623	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	34079550, 36726984, 37072474	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	11012894	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	16097435, 32925281	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28816939, 33832110, 37378945, 38561479	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	19530238, 9155056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	22900064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	CTD_human_DG	18402387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	LHGDN	15201855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10469452, 14632728, 14978790, 15034864, 15068318, 15628907, 15891995, 16234514, 16682728, 16864174, 17013533, 17088909, 17260090, 17453369, 17922046 View all (60 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	11583189, 12006526, 16234514, 22204715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	30132517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10699927, 18078328, 22900064, 26386574, 28231233, 31816603, 31839396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31729978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15762277, 28728050, 29045811, 31297881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17363613, 23398928, 25605014, 29289884, 29335461, 29761838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17363613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	CTD_human_DG	16762588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24291029, 28056823, 28078605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	14566826, 29581849, 31289523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14632727, 15034864, 17100565, 17363613, 17949785, 18332872, 19003983, 21165954, 21288332, 22569122, 22998676, 23222298, 23928695, 24103454, 26051240 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	14673046, 16721726, 18522746, 24040940, 28813519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28736844, 29761838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	11583189, 12006526, 16234514, 22204715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10469452, 14632727, 14978790, 15034864, 16502015, 17100565, 21435434, 21741827, 22204715, 26022247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	11583189, 12006526, 16234514, 22204715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14632727, 15375522, 16234514, 16533774, 16864174, 17922046, 18332872, 18465341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	11583189, 12006526, 16234514, 22204715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mandibuloacral dysplasia with type A lipodystrophy	Mandibuloacral dysplasia	Pubtator	18927283	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	29869738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	29869738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10646909	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16116595, 20543820, 28026870, 37384650	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23020778, 29923182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	11958416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	12204057, 21157382, 37880655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	28301542, 29846894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	28301542	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	25393473	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	33032291, 37172528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	28899973		★★★★★ ★☆☆☆☆ Found in Text Mining only
mixed gliomas	Glioma	CTD_human_DG	18402387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	40455761	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10691864, 18062937, 39769169	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	11425459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	9763573	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	18544048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	23897556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	23897556	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	37861550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nemaline myopathy 5	Nemaline myopathy	Pubtator	15816547	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10469452, 12152158, 14566826, 14673046, 14978790, 15034864, 15891995, 16502015, 16682728, 16864174, 17013533, 17453369, 17638622, 18340528, 19111388 View all (50 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis Interstitial	Interstitial nephritis	Pubtator	11012894	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	16556665, 20187302, 30155617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Neoplasms	Nervous System Neoplasms	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural crest tumor	Neural Crest Tumor	ORPHANET_DG	16682295, 18671248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	ORPHANET_DG	16682295, 18671248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	26575016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	40229714	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	14673046, 28813519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	14673046, 28813519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	28813519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	15255999, 18522746, 24040940, 28813519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nevus comedonicus	Nevus comedonicus	BEFREE	30132517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17639997, 17949785, 19148680, 24135250, 24165483, 24975429, 28231233, 28355294, 29578153, 30709424, 31528121, 31797573, 31816603, 9765623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	26657114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29330624	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	18340528, 22706628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	33244057	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	36700234	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteolysis	Osteolysis	Pubtator	37980167	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	38169377	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	34156352	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	23029477, 23388101, 34414458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	16533424		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31729978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10070864, 16533424, 17433065, 18506140, 19270648, 23029477, 23214297, 23388101, 28728050, 31729978, 31987036, 32693821, 34253236, 34414458, 35047055, 35735060, 7713987, 8172796, 9119751 View all (4 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15762277, 28728050, 29045811, 31297881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	12136248, 19393226, 32537471, 33613108, 37604837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	30214555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	31614754, 31792675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	27818488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	27818488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	12429800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	25692206, 30074233	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Plexiform Neurofibroma	Plexiform neurofibroma	BEFREE	28813519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	12646941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17363613, 23398928, 25605014, 29289884, 29335461, 29761838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16556661, 23251544, 23398928, 26560244, 31967940, 33091733, 33630978, 34198380, 35409038, 36124532, 36245843, 37184661, 38179769	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17363613		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33527765	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	36072642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	27090785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	28755093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	32443297, 33217867	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	CTD_human_DG	16762588		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	19250538	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	BEFREE	22203181		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	33266502	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	34550531	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma Ewing	Sarcoma	Pubtator	15886298	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	10971522	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	26867764, 31675229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	31545448, 9155056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	27090785, 33904373	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	27978524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	35958619	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	20419121, 40229714, 7947097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	1331483, 28275243, 8041119, 8761362, 8980384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	12044890, 18520795, 21455636, 24058603, 29290260, 29845250, 7947097, 8980384, 9652763, 9765623	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	33186389, 34825846	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	19019771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	10744048, 25719218, 31109699, 34268934, 37378945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37667354	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	24135250, 28355294, 31241205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	22203181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19061514, 24291029, 28056823, 28078605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	8780403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	14991576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19061514, 24326092, 25550836, 25684949, 25743022, 25778705, 25815791, 27314292, 28056823, 28078605, 28460635, 29772796, 32902196	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymus Neoplasms	Thymus Neoplasms	BEFREE	23276504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	30213925, 31183379, 33025856, 33455115, 35405742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	16033110	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	31216997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26051240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26051240, 27799773, 30583686	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tumors of Adrenal Cortex	Tumors Of Adrenal Cortex	BEFREE	23533247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	11304849, 23495258, 26981592, 27473264, 29532898, 39456780, 7734314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	LHGDN	16990717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	32181600, 33302814, 33413211, 34705880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33023625	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	16556665, 26274016, 30155617	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TOP2A (DNA topoisomerase II alpha)