Gene Gene information from NCBI Gene database.
Entrez ID 7133
Gene name TNF receptor superfamily member 1B
Gene symbol TNFRSF1B
Synonyms (NCBI Gene)
CD120bTBPIITNF-R-IITNF-R75TNFBRTNFR1BTNFR2TNFR80p75p75TNFR
Chromosome 1
Chromosome location 1p36.22
Summary The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity.
miRNA miRNA information provided by mirtarbase database.
283
miRTarBase ID miRNA Experiments Reference
MIRT717194 hsa-miR-96-3p HITS-CLIP 19536157
MIRT717193 hsa-miR-299-3p HITS-CLIP 19536157
MIRT717192 hsa-miR-3607-5p HITS-CLIP 19536157
MIRT717191 hsa-miR-6884-3p HITS-CLIP 19536157
MIRT717190 hsa-miR-6072 HITS-CLIP 19536157
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
JUN Activation 9743209
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
63
GO ID Ontology Definition Evidence Reference
GO:0002718 Process Regulation of cytokine production involved in immune response IEA
GO:0002718 Process Regulation of cytokine production involved in immune response ISS
GO:0002724 Process Regulation of T cell cytokine production IBA
GO:0002724 Process Regulation of T cell cytokine production IEA
GO:0002724 Process Regulation of T cell cytokine production ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
191191 11917 ENSG00000028137
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P20333
Protein name Tumor necrosis factor receptor superfamily member 1B (Tumor necrosis factor receptor 2) (TNF-R2) (Tumor necrosis factor receptor type II) (TNF-RII) (TNFR-II) (p75) (p80 TNF-alpha receptor) (CD antigen CD120b) (Etanercept) [Cleaved into: Tumor necrosis fac
Protein function Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor media
PDB 1CA9 , 3ALQ , 8HLB , 9CU8
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00020 TNFR_c6 40 75 TNFR/NGFR cysteine-rich region Domain
PF00020 TNFR_c6 78 118 TNFR/NGFR cysteine-rich region Domain
PF00020 TNFR_c6 120 161 TNFR/NGFR cysteine-rich region Domain
Sequence
MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPG
QHAKVFCTKTSDTVC
DSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTC
RPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVC
KPCAPGTFSNTTSSTDICR
PHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTS
FLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNCVIMTQVKKKPLCLQREAKV
PHLPADKARGTQGPEQQHLLITAPSSSSSSLESSASALDRRAPTRNQPQAPGVEASGAGE
ARASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQ
VPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS
Sequence length 461
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
TNF signaling pathway
Adipocytokine signaling pathway
Amyotrophic lateral sclerosis
Pathways of neurodegeneration - multiple diseases
Human immunodeficiency virus 1 infection
  TNFR2 non-canonical NF-kB pathway
TNFs bind their physiological receptors
Interleukin-10 signaling
Interleukin-4 and Interleukin-13 signaling
Neutrophil degranulation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
29
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ANKYLOSING SPONDYLITIS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associated with severe COVID-19 disease Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acne Acne BEFREE 20861605
★☆☆☆☆
Found in Text Mining only
Acne Vulgaris Acne BEFREE 20861605
★☆☆☆☆
Found in Text Mining only
Acute leukemia Leukemia BEFREE 16173964
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 15146559
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of prostate Prostate adenocarcinoma BEFREE 15948150, 20464497
★☆☆☆☆
Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma B-cell Lymphoma BEFREE 23672298
★☆☆☆☆
Found in Text Mining only
Adult Hodgkin Lymphoma Hodgkin Lymphoma BEFREE 29928327
★☆☆☆☆
Found in Text Mining only
Adult Medulloblastoma Medulloblastoma BEFREE 17550129
★☆☆☆☆
Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia T-Cell Lymphoma/Leukemia BEFREE 11163081
★☆☆☆☆
Found in Text Mining only
Adult type dermatomyositis Dermatomyositis BEFREE 10399751
★☆☆☆☆
Found in Text Mining only