Gene Gene information from NCBI Gene database.
Entrez ID 7132
Gene name TNF receptor superfamily member 1A
Gene symbol TNFRSF1A
Synonyms (NCBI Gene)
CD120aFPFTBP1TNF-RTNF-R-ITNF-R55TNFARTNFR1TNFR55TNFR60p55p55-Rp60
Chromosome 12
Chromosome location 12p13.31
Summary This gene encodes a member of the TNF receptor superfamily of proteins. The encoded receptor is found in membrane-bound and soluble forms that interact with membrane-bound and soluble forms, respectively, of its ligand, tumor necrosis factor alpha. Bindin
SNPs SNP information provided by dbSNP.
26
SNP ID Visualize variation Clinical significance Consequence
rs1800693 T>C Benign, risk-factor, likely-benign Intron variant
rs4149584 C>G,T Conflicting-interpretations-of-pathogenicity, pathogenic Coding sequence variant, 5 prime UTR variant, missense variant, non coding transcript variant
rs34751757 G>A,T Not-provided, conflicting-interpretations-of-pathogenicity Non coding transcript variant, 5 prime UTR variant, coding sequence variant, missense variant
rs104895217 A>G Pathogenic Non coding transcript variant, 5 prime UTR variant, intron variant, coding sequence variant, missense variant
rs104895218 C>T Pathogenic Non coding transcript variant, 5 prime UTR variant, intron variant, coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
127
miRTarBase ID miRNA Experiments Reference
MIRT051697 hsa-let-7e-5p CLASH 23622248
MIRT1443001 hsa-miR-1197 CLIP-seq
MIRT1443002 hsa-miR-1266 CLIP-seq
MIRT1443003 hsa-miR-194 CLIP-seq
MIRT1443004 hsa-miR-1973 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
84
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IDA 22801493
GO:0000139 Component Golgi membrane IEA
GO:0002947 Component Tumor necrosis factor receptor superfamily complex TAS 24966471
GO:0003176 Process Aortic valve development IEA
GO:0003176 Process Aortic valve development ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
191190 11916 ENSG00000067182
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P19438
Protein name Tumor necrosis factor receptor superfamily member 1A (Tumor necrosis factor receptor 1) (TNF-R1) (Tumor necrosis factor receptor type I) (TNF-RI) (TNFR-I) (p55) (p60) (CD antigen CD120a) [Cleaved into: Tumor necrosis factor receptor superfamily member 1A,
Protein function Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation whic
PDB 1EXT , 1FT4 , 1ICH , 1NCF , 1TNR , 7K7A , 7KP7 , 7KP8 , 7KPB , 8P6Q
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00020 TNFR_c6 44 81 TNFR/NGFR cysteine-rich region Domain
PF00020 TNFR_c6 84 125 TNFR/NGFR cysteine-rich region Domain
PF00020 TNFR_c6 127 166 TNFR/NGFR cysteine-rich region Domain
PF00531 Death 356 441 Death domain Domain
Sequence
MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCT
KCHKGTYLYNDCPGPGQDTDC
RECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD
RDTVC
GCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECV
SCSNCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWK
SKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFTPTLGFSPVPSSTFTSSSTYT
PGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLY
AVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLEL
LGRVLRDMDLLGCLEDIEEAL
CGPAALPPAPSLLR
Sequence length 455
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  MAPK signaling pathway
Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
NF-kappa B signaling pathway
Sphingolipid signaling pathway
mTOR signaling pathway
Apoptosis
Apoptosis - multiple species
Necroptosis
Osteoclast differentiation
TNF signaling pathway
Adipocytokine signaling pathway
Insulin resistance
Non-alcoholic fatty liver disease
Alcoholic liver disease
Alzheimer disease
Amyotrophic lateral sclerosis
Pathways of neurodegeneration - multiple diseases
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Chagas disease
Toxoplasmosis
Tuberculosis
Hepatitis C
Human cytomegalovirus infection
Influenza A
Human papillomavirus infection
Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
Herpes simplex virus 1 infection
Human immunodeficiency virus 1 infection
Coronavirus disease - COVID-19
Lipid and atherosclerosis
Fluid shear stress and atherosclerosis
  TNFR1-induced proapoptotic signaling
Regulation of TNFR1 signaling
TNFR1-induced NFkappaB signaling pathway
TNFR1-mediated ceramide production
TNFs bind their physiological receptors
Interleukin-10 signaling
TNF signaling
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
53
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Autoinflammatory syndrome Likely pathogenic; Pathogenic rs104895271, rs104895238, rs104895252 RCV002262667
RCV002262668
RCV002264542
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Behcet disease Pathogenic rs886039866 RCV000258049
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
CHARGE syndrome Pathogenic rs1592047560 RCV000984328
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Multiple sclerosis Pathogenic rs104895219 RCV004798724
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ANKYLOSING SPONDYLITIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS AND OTHER INFLAMMATORY SPONDYLOPATHIES Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANOREXIA CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associated with severe COVID-19 disease Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
AA amyloidosis AA amyloidosis BEFREE 11318938, 12105243, 15071491, 15316120
★☆☆☆☆
Found in Text Mining only
Acute Inflammatory Demyelinating Polyneuropathy Inflammatory Demyelinating Polyneuropathy BEFREE 18717726
★☆☆☆☆
Found in Text Mining only
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 2243505
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 15146559, 29985074
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 9685865
★☆☆☆☆
Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia T-Cell Lymphoma/Leukemia BEFREE 11163081
★☆☆☆☆
Found in Text Mining only
Alveolitis Extrinsic Allergic Extrinsic allergic alveolitis Pubtator 15929959 Associate
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 20110607, 24685635, 26621834 Associate
★☆☆☆☆
Found in Text Mining only
Ameloblastoma Ameloblastoma LHGDN 12147741
★☆☆☆☆
Found in Text Mining only
Amyloid nephropathy Amyloid Nephropathy BEFREE 12105243, 12832748
★☆☆☆☆
Found in Text Mining only