TNFAIP3 (TNF alpha induced protein 3)

Gene

• Entrez ID: 7128
• Gene name: TNF alpha induced protein 3
• Gene symbol: TNFAIP3
• Synonyms (NCBI Gene): A20, AIFBL1, AISBL, OTUD7C, TNFA1P2
• Chromosome: 6
• Chromosome location: 6q23.3
• Summary: This gene was identified as a gene whose expression is rapidly induced by the tumor necrosis factor (TNF). The protein encoded by this gene is a zinc finger protein and ubiqitin-editing enzyme, and has been shown to inhibit NF-kappa B activation as well a

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs864321625	T>A	Pathogenic	Stop gained, coding sequence variant
rs864321626	C>T	Pathogenic	Stop gained, coding sequence variant
rs864321682	T>-	Pathogenic	Frameshift variant, coding sequence variant
rs864321683	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs864321684	C>G	Pathogenic	Stop gained, coding sequence variant
rs864321685	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs1064796470	CT>-	Pathogenic	Coding sequence variant, frameshift variant
rs1554225021	T>C	Pathogenic	Missense variant, coding sequence variant
rs1582892979	GGAG>AGGAA	Pathogenic	Coding sequence variant, frameshift variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005955	hsa-miR-21-5p	Luciferase reporter assay	21131358
MIRT005955	hsa-miR-21-5p	Luciferase reporter assay	21131358
MIRT006380	hsa-miR-29a-3p	Luciferase reporter assay	21763284
MIRT006380	hsa-miR-29a-3p	Luciferase reporter assay	21763284
MIRT006471	hsa-miR-125a-5p	qRT-PCR, Western blot	22550173
MIRT006472	hsa-miR-125b-5p	qRT-PCR, Western blot	22550173
MIRT006380	hsa-miR-29a-3p	Luciferase reporter assay	21763284
MIRT006472	hsa-miR-125b-5p	qRT-PCR, Western blot	22550173
MIRT029863	hsa-miR-26b-5p	Microarray	19088304
MIRT030581	hsa-miR-24-3p	Microarray	19748357
MIRT621770	hsa-miR-5700	HITS-CLIP	23824327
MIRT621769	hsa-miR-2278	HITS-CLIP	23824327
MIRT621768	hsa-miR-586	HITS-CLIP	23824327
MIRT621767	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT621766	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT621765	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT621764	hsa-miR-520g-5p	HITS-CLIP	23824327
MIRT621763	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT621762	hsa-miR-518d-5p	HITS-CLIP	23824327
MIRT621761	hsa-miR-518e-5p	HITS-CLIP	23824327
MIRT621760	hsa-miR-518f-5p	HITS-CLIP	23824327
MIRT621759	hsa-miR-519a-5p	HITS-CLIP	23824327
MIRT621758	hsa-miR-519b-5p	HITS-CLIP	23824327
MIRT621757	hsa-miR-519c-5p	HITS-CLIP	23824327
MIRT621756	hsa-miR-520c-5p	HITS-CLIP	23824327
MIRT621755	hsa-miR-522-5p	HITS-CLIP	23824327
MIRT621754	hsa-miR-523-5p	HITS-CLIP	23824327
MIRT621753	hsa-miR-526a	HITS-CLIP	23824327
MIRT621752	hsa-miR-4777-5p	HITS-CLIP	23824327
MIRT621751	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT621750	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT621749	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT621748	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT621770	hsa-miR-5700	HITS-CLIP	23824327
MIRT621769	hsa-miR-2278	HITS-CLIP	23824327
MIRT621768	hsa-miR-586	HITS-CLIP	23824327
MIRT621767	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT621766	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT621765	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT621764	hsa-miR-520g-5p	HITS-CLIP	23824327
MIRT621763	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT621762	hsa-miR-518d-5p	HITS-CLIP	23824327
MIRT621761	hsa-miR-518e-5p	HITS-CLIP	23824327
MIRT621760	hsa-miR-518f-5p	HITS-CLIP	23824327
MIRT621759	hsa-miR-519a-5p	HITS-CLIP	23824327
MIRT621758	hsa-miR-519b-5p	HITS-CLIP	23824327
MIRT621757	hsa-miR-519c-5p	HITS-CLIP	23824327
MIRT621756	hsa-miR-520c-5p	HITS-CLIP	23824327
MIRT621755	hsa-miR-522-5p	HITS-CLIP	23824327
MIRT621754	hsa-miR-523-5p	HITS-CLIP	23824327
MIRT621753	hsa-miR-526a	HITS-CLIP	23824327
MIRT621752	hsa-miR-4777-5p	HITS-CLIP	23824327
MIRT621751	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT621750	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT621749	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT621748	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT621770	hsa-miR-5700	HITS-CLIP	23824327
MIRT621769	hsa-miR-2278	HITS-CLIP	23824327
MIRT621768	hsa-miR-586	HITS-CLIP	23824327
MIRT621767	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT621766	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT621765	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT621764	hsa-miR-520g-5p	HITS-CLIP	23824327
MIRT621763	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT621762	hsa-miR-518d-5p	HITS-CLIP	23824327
MIRT621761	hsa-miR-518e-5p	HITS-CLIP	23824327
MIRT621760	hsa-miR-518f-5p	HITS-CLIP	23824327
MIRT621759	hsa-miR-519a-5p	HITS-CLIP	23824327
MIRT621758	hsa-miR-519b-5p	HITS-CLIP	23824327
MIRT621757	hsa-miR-519c-5p	HITS-CLIP	23824327
MIRT621756	hsa-miR-520c-5p	HITS-CLIP	23824327
MIRT621755	hsa-miR-522-5p	HITS-CLIP	23824327
MIRT621754	hsa-miR-523-5p	HITS-CLIP	23824327
MIRT621753	hsa-miR-526a	HITS-CLIP	23824327
MIRT621752	hsa-miR-4777-5p	HITS-CLIP	23824327
MIRT621751	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT621750	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT621749	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT621748	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT553493	hsa-miR-23c	PAR-CLIP	21572407
MIRT553492	hsa-miR-23b-3p	PAR-CLIP	21572407
MIRT553491	hsa-miR-130a-5p	PAR-CLIP	21572407
MIRT553490	hsa-miR-23a-3p	PAR-CLIP	21572407
MIRT553489	hsa-miR-6507-5p	PAR-CLIP	21572407
MIRT553488	hsa-miR-580-5p	PAR-CLIP	21572407
MIRT553487	hsa-miR-3688-3p	PAR-CLIP	21572407
MIRT553486	hsa-miR-5093	PAR-CLIP	21572407
MIRT553485	hsa-miR-3653-3p	PAR-CLIP	21572407
MIRT553484	hsa-miR-505-3p	PAR-CLIP	21572407
MIRT553483	hsa-miR-3658	PAR-CLIP	21572407
MIRT553482	hsa-miR-5096	PAR-CLIP	21572407
MIRT553481	hsa-miR-335-3p	PAR-CLIP	21572407
MIRT448422	hsa-miR-5692a	PAR-CLIP	22100165
MIRT450585	hsa-miR-141-5p	PAR-CLIP	22100165
MIRT448421	hsa-miR-412-3p	PAR-CLIP	22100165
MIRT448420	hsa-miR-6754-3p	PAR-CLIP	22100165
MIRT448419	hsa-miR-6837-3p	PAR-CLIP	22100165
MIRT448406	hsa-miR-4635	PAR-CLIP	22100165
MIRT448418	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT448417	hsa-miR-3616-5p	PAR-CLIP	22100165
MIRT448416	hsa-miR-573	PAR-CLIP	22100165
MIRT448422	hsa-miR-5692a	PAR-CLIP	22100165
MIRT448421	hsa-miR-412-3p	PAR-CLIP	22100165
MIRT448420	hsa-miR-6754-3p	PAR-CLIP	22100165
MIRT448419	hsa-miR-6837-3p	PAR-CLIP	22100165
MIRT448418	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT448417	hsa-miR-3616-5p	PAR-CLIP	22100165
MIRT448416	hsa-miR-573	PAR-CLIP	22100165
MIRT448415	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT448414	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT448413	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT448412	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT448411	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT448410	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT448409	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT448408	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT448407	hsa-miR-4729	PAR-CLIP	22100165
MIRT448406	hsa-miR-4635	PAR-CLIP	22100165
MIRT448405	hsa-miR-3185	PAR-CLIP	22100165
MIRT448403	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT439414	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT726266	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT726265	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT439414	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT006472	hsa-miR-125b-5p	Luciferase reporter assay, qRT-PCR, Western blot	27637078
MIRT006472	hsa-miR-125b-5p	Luciferase reporter assay, qRT-PCR, Western blot	27637078
MIRT726265	hsa-miR-19b-3p	Luciferase reporter assay, qRT-PCR, Western blot	27919278
MIRT726265	hsa-miR-19b-3p	Luciferase reporter assay, qRT-PCR, Western blot	27919278
MIRT726266	hsa-miR-19a-3p	Luciferase reporter assay, qRT-PCR, Western blot	26367773
MIRT006471	hsa-miR-125a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26758190
MIRT006471	hsa-miR-125a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26758190
MIRT006472	hsa-miR-125b-5p	qRT-PCR	32039213
MIRT553490	hsa-miR-23a-3p	Luciferase reporter assay, Western blotting, RNA-seq, qRT-PCR	34201504
MIRT736719	hsa-miR-605-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31452243
MIRT621770	hsa-miR-5700	HITS-CLIP	23824327
MIRT621769	hsa-miR-2278	HITS-CLIP	23824327
MIRT621768	hsa-miR-586	HITS-CLIP	23824327
MIRT621767	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT621766	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT621765	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT621764	hsa-miR-520g-5p	HITS-CLIP	23824327
MIRT621763	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT621762	hsa-miR-518d-5p	HITS-CLIP	23824327
MIRT621761	hsa-miR-518e-5p	HITS-CLIP	23824327
MIRT621760	hsa-miR-518f-5p	HITS-CLIP	23824327
MIRT621759	hsa-miR-519a-5p	HITS-CLIP	23824327
MIRT621758	hsa-miR-519b-5p	HITS-CLIP	23824327
MIRT621757	hsa-miR-519c-5p	HITS-CLIP	23824327
MIRT621756	hsa-miR-520c-5p	HITS-CLIP	23824327
MIRT621755	hsa-miR-522-5p	HITS-CLIP	23824327
MIRT621754	hsa-miR-523-5p	HITS-CLIP	23824327
MIRT621753	hsa-miR-526a	HITS-CLIP	23824327
MIRT621752	hsa-miR-4777-5p	HITS-CLIP	23824327
MIRT621751	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT621750	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT621749	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT621748	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT621770	hsa-miR-5700	HITS-CLIP	23824327
MIRT621769	hsa-miR-2278	HITS-CLIP	23824327
MIRT621768	hsa-miR-586	HITS-CLIP	23824327
MIRT621767	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT621766	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT621765	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT621764	hsa-miR-520g-5p	HITS-CLIP	23824327
MIRT621763	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT621762	hsa-miR-518d-5p	HITS-CLIP	23824327
MIRT621761	hsa-miR-518e-5p	HITS-CLIP	23824327
MIRT621760	hsa-miR-518f-5p	HITS-CLIP	23824327
MIRT621759	hsa-miR-519a-5p	HITS-CLIP	23824327
MIRT621758	hsa-miR-519b-5p	HITS-CLIP	23824327
MIRT621757	hsa-miR-519c-5p	HITS-CLIP	23824327
MIRT621756	hsa-miR-520c-5p	HITS-CLIP	23824327
MIRT621755	hsa-miR-522-5p	HITS-CLIP	23824327
MIRT621754	hsa-miR-523-5p	HITS-CLIP	23824327
MIRT621753	hsa-miR-526a	HITS-CLIP	23824327
MIRT621752	hsa-miR-4777-5p	HITS-CLIP	23824327
MIRT621751	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT621750	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT621749	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT621748	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT621770	hsa-miR-5700	HITS-CLIP	23824327
MIRT621769	hsa-miR-2278	HITS-CLIP	23824327
MIRT621768	hsa-miR-586	HITS-CLIP	23824327
MIRT621767	hsa-miR-6887-3p	HITS-CLIP	23824327
MIRT621766	hsa-miR-6795-3p	HITS-CLIP	23824327
MIRT621765	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT621764	hsa-miR-520g-5p	HITS-CLIP	23824327
MIRT621763	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT621762	hsa-miR-518d-5p	HITS-CLIP	23824327
MIRT621761	hsa-miR-518e-5p	HITS-CLIP	23824327
MIRT621760	hsa-miR-518f-5p	HITS-CLIP	23824327
MIRT621759	hsa-miR-519a-5p	HITS-CLIP	23824327
MIRT621758	hsa-miR-519b-5p	HITS-CLIP	23824327
MIRT621757	hsa-miR-519c-5p	HITS-CLIP	23824327
MIRT621756	hsa-miR-520c-5p	HITS-CLIP	23824327
MIRT621755	hsa-miR-522-5p	HITS-CLIP	23824327
MIRT621754	hsa-miR-523-5p	HITS-CLIP	23824327
MIRT621753	hsa-miR-526a	HITS-CLIP	23824327
MIRT621752	hsa-miR-4777-5p	HITS-CLIP	23824327
MIRT621751	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT621750	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT621749	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT621748	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT553493	hsa-miR-23c	PAR-CLIP	21572407
MIRT553492	hsa-miR-23b-3p	PAR-CLIP	21572407
MIRT553491	hsa-miR-130a-5p	PAR-CLIP	21572407
MIRT553490	hsa-miR-23a-3p	PAR-CLIP	21572407
MIRT553489	hsa-miR-6507-5p	PAR-CLIP	21572407
MIRT553488	hsa-miR-580-5p	PAR-CLIP	21572407
MIRT553487	hsa-miR-3688-3p	PAR-CLIP	21572407
MIRT553486	hsa-miR-5093	PAR-CLIP	21572407
MIRT553485	hsa-miR-3653-3p	PAR-CLIP	21572407
MIRT553484	hsa-miR-505-3p	PAR-CLIP	21572407
MIRT553483	hsa-miR-3658	PAR-CLIP	21572407
MIRT553482	hsa-miR-5096	PAR-CLIP	21572407
MIRT553481	hsa-miR-335-3p	PAR-CLIP	21572407
MIRT448422	hsa-miR-5692a	PAR-CLIP	22100165
MIRT450585	hsa-miR-141-5p	PAR-CLIP	22100165
MIRT448421	hsa-miR-412-3p	PAR-CLIP	22100165
MIRT448420	hsa-miR-6754-3p	PAR-CLIP	22100165
MIRT448419	hsa-miR-6837-3p	PAR-CLIP	22100165
MIRT448406	hsa-miR-4635	PAR-CLIP	22100165
MIRT448418	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT448417	hsa-miR-3616-5p	PAR-CLIP	22100165
MIRT448416	hsa-miR-573	PAR-CLIP	22100165
MIRT448422	hsa-miR-5692a	PAR-CLIP	22100165
MIRT448421	hsa-miR-412-3p	PAR-CLIP	22100165
MIRT448420	hsa-miR-6754-3p	PAR-CLIP	22100165
MIRT448419	hsa-miR-6837-3p	PAR-CLIP	22100165
MIRT448418	hsa-miR-4670-3p	PAR-CLIP	22100165
MIRT448417	hsa-miR-3616-5p	PAR-CLIP	22100165
MIRT448416	hsa-miR-573	PAR-CLIP	22100165
MIRT448415	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT448414	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT448413	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT448412	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT448411	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT448410	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT448409	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT448408	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT448407	hsa-miR-4729	PAR-CLIP	22100165
MIRT448406	hsa-miR-4635	PAR-CLIP	22100165
MIRT448405	hsa-miR-3185	PAR-CLIP	22100165
MIRT448403	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT1442249	hsa-miR-1208	CLIP-seq
MIRT1442250	hsa-miR-1238	CLIP-seq
MIRT1442251	hsa-miR-1324	CLIP-seq
MIRT1442252	hsa-miR-186	CLIP-seq
MIRT1442253	hsa-miR-193a-3p	CLIP-seq
MIRT1442254	hsa-miR-193b	CLIP-seq
MIRT1442255	hsa-miR-1976	CLIP-seq
MIRT1442256	hsa-miR-3065-5p	CLIP-seq
MIRT1442257	hsa-miR-3119	CLIP-seq
MIRT1442258	hsa-miR-3124-3p	CLIP-seq
MIRT1442259	hsa-miR-3140-3p	CLIP-seq
MIRT1442260	hsa-miR-3160-5p	CLIP-seq
MIRT1442261	hsa-miR-3183	CLIP-seq
MIRT1442262	hsa-miR-3184	CLIP-seq
MIRT1442263	hsa-miR-370	CLIP-seq
MIRT1442264	hsa-miR-3914	CLIP-seq
MIRT1442265	hsa-miR-409-5p	CLIP-seq
MIRT1442266	hsa-miR-423-5p	CLIP-seq
MIRT1442267	hsa-miR-4257	CLIP-seq
MIRT1442268	hsa-miR-4519	CLIP-seq
MIRT1442269	hsa-miR-4684-3p	CLIP-seq
MIRT1442270	hsa-miR-4723-3p	CLIP-seq
MIRT1442271	hsa-miR-4736	CLIP-seq
MIRT1442272	hsa-miR-4797-5p	CLIP-seq
MIRT1442273	hsa-miR-491-3p	CLIP-seq
MIRT1442274	hsa-miR-563	CLIP-seq
MIRT1442275	hsa-miR-626	CLIP-seq
MIRT1442276	hsa-miR-767-3p	CLIP-seq
MIRT1442277	hsa-miR-873	CLIP-seq
MIRT1442278	hsa-miR-885-3p	CLIP-seq
MIRT1442279	hsa-miR-892b	CLIP-seq
MIRT1555049	hsa-miR-18a	CLIP-seq
MIRT1555050	hsa-miR-18b	CLIP-seq
MIRT1555051	hsa-miR-4735-3p	CLIP-seq
MIRT1555052	hsa-miR-4735-5p	CLIP-seq
MIRT1555053	hsa-miR-4775	CLIP-seq
MIRT1555054	hsa-miR-576-5p	CLIP-seq
MIRT1555055	hsa-miR-590-3p	CLIP-seq
MIRT2132408	hsa-miR-1237	CLIP-seq
MIRT2132409	hsa-miR-1248	CLIP-seq
MIRT2132410	hsa-miR-1343	CLIP-seq
MIRT1555049	hsa-miR-18a	CLIP-seq
MIRT1555050	hsa-miR-18b	CLIP-seq
MIRT2132411	hsa-miR-3074-5p	CLIP-seq
MIRT1442258	hsa-miR-3124-3p	CLIP-seq
MIRT2132412	hsa-miR-3150a-3p	CLIP-seq
MIRT2132413	hsa-miR-3175	CLIP-seq
MIRT2132414	hsa-miR-376c	CLIP-seq
MIRT2132415	hsa-miR-4667-5p	CLIP-seq
MIRT2132416	hsa-miR-4700-5p	CLIP-seq
MIRT1555051	hsa-miR-4735-3p	CLIP-seq
MIRT1555052	hsa-miR-4735-5p	CLIP-seq
MIRT1555053	hsa-miR-4775	CLIP-seq
MIRT2132417	hsa-miR-548aa	CLIP-seq
MIRT2132418	hsa-miR-556-3p	CLIP-seq
MIRT1555054	hsa-miR-576-5p	CLIP-seq
MIRT1555055	hsa-miR-590-3p	CLIP-seq
MIRT2132419	hsa-miR-939	CLIP-seq
MIRT2353440	hsa-miR-128	CLIP-seq
MIRT2353441	hsa-miR-27a	CLIP-seq
MIRT2353442	hsa-miR-27b	CLIP-seq
MIRT1442267	hsa-miR-4257	CLIP-seq
MIRT2353443	hsa-miR-455-3p	CLIP-seq
MIRT1442272	hsa-miR-4797-5p	CLIP-seq
MIRT2396097	hsa-miR-4446-5p	CLIP-seq
MIRT2396098	hsa-miR-4755-5p	CLIP-seq
MIRT2441399	hsa-miR-1202	CLIP-seq
MIRT2441400	hsa-miR-1265	CLIP-seq
MIRT2441401	hsa-miR-1266	CLIP-seq
MIRT2441402	hsa-miR-1286	CLIP-seq
MIRT2441403	hsa-miR-141	CLIP-seq
MIRT2441404	hsa-miR-188-5p	CLIP-seq
MIRT2441405	hsa-miR-200a	CLIP-seq
MIRT2441406	hsa-miR-2117	CLIP-seq
MIRT2441407	hsa-miR-2277-3p	CLIP-seq
MIRT2441408	hsa-miR-330-3p	CLIP-seq
MIRT2441409	hsa-miR-3664-3p	CLIP-seq
MIRT2441410	hsa-miR-3688-5p	CLIP-seq
MIRT2441411	hsa-miR-3689d	CLIP-seq
MIRT2441412	hsa-miR-3913-3p	CLIP-seq
MIRT2441413	hsa-miR-3972	CLIP-seq
MIRT2441414	hsa-miR-4273	CLIP-seq
MIRT2441415	hsa-miR-4286	CLIP-seq
MIRT2441416	hsa-miR-4318	CLIP-seq
MIRT2441417	hsa-miR-4433	CLIP-seq
MIRT2396097	hsa-miR-4446-5p	CLIP-seq
MIRT2441418	hsa-miR-4459	CLIP-seq
MIRT2441419	hsa-miR-4518	CLIP-seq
MIRT2441420	hsa-miR-4722-5p	CLIP-seq
MIRT2441421	hsa-miR-4753-5p	CLIP-seq
MIRT2441422	hsa-miR-4758-3p	CLIP-seq
MIRT2441423	hsa-miR-4768-3p	CLIP-seq
MIRT2441424	hsa-miR-4768-5p	CLIP-seq
MIRT2441425	hsa-miR-4780	CLIP-seq
MIRT2441426	hsa-miR-489	CLIP-seq
MIRT2441427	hsa-miR-623	CLIP-seq
MIRT2441428	hsa-miR-888	CLIP-seq
MIRT2441429	hsa-miR-935	CLIP-seq
MIRT2647426	hsa-let-7a	CLIP-seq
MIRT2647427	hsa-let-7b	CLIP-seq
MIRT2647428	hsa-let-7c	CLIP-seq
MIRT2647429	hsa-let-7d	CLIP-seq
MIRT2647430	hsa-let-7e	CLIP-seq
MIRT2647431	hsa-let-7f	CLIP-seq
MIRT2647432	hsa-let-7g	CLIP-seq
MIRT2647433	hsa-let-7i	CLIP-seq
MIRT2441399	hsa-miR-1202	CLIP-seq
MIRT2647434	hsa-miR-1207-3p	CLIP-seq
MIRT2647435	hsa-miR-1256	CLIP-seq
MIRT2441400	hsa-miR-1265	CLIP-seq
MIRT2441401	hsa-miR-1266	CLIP-seq
MIRT2441403	hsa-miR-141	CLIP-seq
MIRT2441404	hsa-miR-188-5p	CLIP-seq
MIRT2441405	hsa-miR-200a	CLIP-seq
MIRT2647436	hsa-miR-204	CLIP-seq
MIRT2647437	hsa-miR-211	CLIP-seq
MIRT2647438	hsa-miR-2110	CLIP-seq
MIRT2441406	hsa-miR-2117	CLIP-seq
MIRT2647439	hsa-miR-2355-5p	CLIP-seq
MIRT2647440	hsa-miR-3160-3p	CLIP-seq
MIRT1442260	hsa-miR-3160-5p	CLIP-seq
MIRT2647441	hsa-miR-3173-3p	CLIP-seq
MIRT2647442	hsa-miR-326	CLIP-seq
MIRT2441408	hsa-miR-330-3p	CLIP-seq
MIRT2647443	hsa-miR-330-5p	CLIP-seq
MIRT2647444	hsa-miR-3647-5p	CLIP-seq
MIRT2441409	hsa-miR-3664-3p	CLIP-seq
MIRT2647445	hsa-miR-3675-3p	CLIP-seq
MIRT2441410	hsa-miR-3688-5p	CLIP-seq
MIRT2647446	hsa-miR-3714	CLIP-seq
MIRT2441412	hsa-miR-3913-3p	CLIP-seq
MIRT2647447	hsa-miR-3941	CLIP-seq
MIRT2441413	hsa-miR-3972	CLIP-seq
MIRT2647448	hsa-miR-412	CLIP-seq
MIRT2647449	hsa-miR-4263	CLIP-seq
MIRT2647450	hsa-miR-4271	CLIP-seq
MIRT2441414	hsa-miR-4273	CLIP-seq
MIRT2647451	hsa-miR-4287	CLIP-seq
MIRT2441416	hsa-miR-4318	CLIP-seq
MIRT2441417	hsa-miR-4433	CLIP-seq
MIRT2396097	hsa-miR-4446-5p	CLIP-seq
MIRT2647452	hsa-miR-4458	CLIP-seq
MIRT2441418	hsa-miR-4459	CLIP-seq
MIRT2647453	hsa-miR-4500	CLIP-seq
MIRT2441419	hsa-miR-4518	CLIP-seq
MIRT1442268	hsa-miR-4519	CLIP-seq
MIRT2647454	hsa-miR-4521	CLIP-seq
MIRT2647455	hsa-miR-466	CLIP-seq
MIRT2132415	hsa-miR-4667-5p	CLIP-seq
MIRT2647456	hsa-miR-4668-5p	CLIP-seq
MIRT2647457	hsa-miR-4672	CLIP-seq
MIRT2647458	hsa-miR-4685-3p	CLIP-seq
MIRT2647459	hsa-miR-4698	CLIP-seq
MIRT2132416	hsa-miR-4700-5p	CLIP-seq
MIRT2647460	hsa-miR-4717-5p	CLIP-seq
MIRT2647461	hsa-miR-4725-3p	CLIP-seq
MIRT2647462	hsa-miR-4731-3p	CLIP-seq
MIRT2441421	hsa-miR-4753-5p	CLIP-seq
MIRT2647463	hsa-miR-4759	CLIP-seq
MIRT2441423	hsa-miR-4768-3p	CLIP-seq
MIRT2441424	hsa-miR-4768-5p	CLIP-seq
MIRT2441425	hsa-miR-4780	CLIP-seq
MIRT2647464	hsa-miR-4789-5p	CLIP-seq
MIRT2647465	hsa-miR-4801	CLIP-seq
MIRT2441426	hsa-miR-489	CLIP-seq
MIRT1442273	hsa-miR-491-3p	CLIP-seq
MIRT2647466	hsa-miR-515-5p	CLIP-seq
MIRT2647467	hsa-miR-548an	CLIP-seq
MIRT1442274	hsa-miR-563	CLIP-seq
MIRT1555054	hsa-miR-576-5p	CLIP-seq
MIRT2441427	hsa-miR-623	CLIP-seq
MIRT2647468	hsa-miR-637	CLIP-seq
MIRT1442278	hsa-miR-885-3p	CLIP-seq
MIRT2441428	hsa-miR-888	CLIP-seq
MIRT2441429	hsa-miR-935	CLIP-seq
MIRT2647469	hsa-miR-98	CLIP-seq
MIRT2441399	hsa-miR-1202	CLIP-seq
MIRT2647435	hsa-miR-1256	CLIP-seq
MIRT2441400	hsa-miR-1265	CLIP-seq
MIRT2441401	hsa-miR-1266	CLIP-seq
MIRT2693653	hsa-miR-1292	CLIP-seq
MIRT2441403	hsa-miR-141	CLIP-seq
MIRT2441404	hsa-miR-188-5p	CLIP-seq
MIRT2441405	hsa-miR-200a	CLIP-seq
MIRT2647438	hsa-miR-2110	CLIP-seq
MIRT2441406	hsa-miR-2117	CLIP-seq
MIRT2647439	hsa-miR-2355-5p	CLIP-seq
MIRT2647440	hsa-miR-3160-3p	CLIP-seq
MIRT1442260	hsa-miR-3160-5p	CLIP-seq
MIRT2647442	hsa-miR-326	CLIP-seq
MIRT2441408	hsa-miR-330-3p	CLIP-seq
MIRT2647443	hsa-miR-330-5p	CLIP-seq
MIRT2441409	hsa-miR-3664-3p	CLIP-seq
MIRT2647445	hsa-miR-3675-3p	CLIP-seq
MIRT2441410	hsa-miR-3688-5p	CLIP-seq
MIRT2441412	hsa-miR-3913-3p	CLIP-seq
MIRT2441413	hsa-miR-3972	CLIP-seq
MIRT2647449	hsa-miR-4263	CLIP-seq
MIRT2647450	hsa-miR-4271	CLIP-seq
MIRT2441414	hsa-miR-4273	CLIP-seq
MIRT2441416	hsa-miR-4318	CLIP-seq
MIRT2441417	hsa-miR-4433	CLIP-seq
MIRT2396097	hsa-miR-4446-5p	CLIP-seq
MIRT2441418	hsa-miR-4459	CLIP-seq
MIRT2693654	hsa-miR-4471	CLIP-seq
MIRT2441419	hsa-miR-4518	CLIP-seq
MIRT2647454	hsa-miR-4521	CLIP-seq
MIRT2693655	hsa-miR-4646-5p	CLIP-seq
MIRT2132415	hsa-miR-4667-5p	CLIP-seq
MIRT2647456	hsa-miR-4668-5p	CLIP-seq
MIRT2647459	hsa-miR-4698	CLIP-seq
MIRT2132416	hsa-miR-4700-5p	CLIP-seq
MIRT2647460	hsa-miR-4717-5p	CLIP-seq
MIRT2647461	hsa-miR-4725-3p	CLIP-seq
MIRT2441421	hsa-miR-4753-5p	CLIP-seq
MIRT2441423	hsa-miR-4768-3p	CLIP-seq
MIRT2441424	hsa-miR-4768-5p	CLIP-seq
MIRT2441425	hsa-miR-4780	CLIP-seq
MIRT2441426	hsa-miR-489	CLIP-seq
MIRT1555054	hsa-miR-576-5p	CLIP-seq
MIRT2441427	hsa-miR-623	CLIP-seq
MIRT2647468	hsa-miR-637	CLIP-seq
MIRT1442278	hsa-miR-885-3p	CLIP-seq
MIRT2441428	hsa-miR-888	CLIP-seq
MIRT2441429	hsa-miR-935	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Activation	11880364;19343319
NFKB1	Unknown	10807933
PML	Repression	12080044
REL	Activation	11880364
RELA	Activation	11880364;19343319
RELA	Unknown	10807933

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001922	Process	B-1 B cell homeostasis	IEA
GO:0001922	Process	B-1 B cell homeostasis	ISS
GO:0002020	Function	Protease binding	IPI	18223652
GO:0002237	Process	Response to molecule of bacterial origin	IDA	19912257
GO:0002237	Process	Response to molecule of bacterial origin	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002634	Process	Regulation of germinal center formation	IEA
GO:0002634	Process	Regulation of germinal center formation	ISS
GO:0002677	Process	Negative regulation of chronic inflammatory response	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	15258597
GO:0004843	Function	Cysteine-type deubiquitinase activity	IBA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IDA	15258597, 23827681
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IMP	15258597
GO:0004843	Function	Cysteine-type deubiquitinase activity	TAS	20392859
GO:0005515	Function	Protein binding	IPI	9299557, 11463333, 15142865, 15169888, 15231748, 15474016, 19060883, 19131965, 20392859, 20936779, 21988832, 23032186, 25416956, 30561431, 31015422, 31515488, 32296183, 33961781, 36931259
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	11463333
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006508	Process	Proteolysis	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007010	Process	Cytoskeleton organization	IBA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010803	Process	Regulation of tumor necrosis factor-mediated signaling pathway	TAS
GO:0016477	Process	Cell migration	IBA
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016579	Process	Protein deubiquitination	TAS	20392859
GO:0016740	Function	Transferase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019899	Function	Enzyme binding	IEA
GO:0019900	Function	Kinase binding	IEA
GO:0030177	Process	Positive regulation of Wnt signaling pathway	IBA
GO:0031397	Process	Negative regulation of protein ubiquitination	IDA	20392859
GO:0032495	Process	Response to muramyl dipeptide	IEA
GO:0032691	Process	Negative regulation of interleukin-1 beta production	IEA
GO:0032691	Process	Negative regulation of interleukin-1 beta production	IMP	28094437
GO:0032703	Process	Negative regulation of interleukin-2 production	IMP	18223652
GO:0032715	Process	Negative regulation of interleukin-6 production	IEA
GO:0032715	Process	Negative regulation of interleukin-6 production	ISS
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	ISS
GO:0034136	Process	Negative regulation of toll-like receptor 2 signaling pathway	NAS	15142865
GO:0034140	Process	Negative regulation of toll-like receptor 3 signaling pathway	IDA	15474016
GO:0034144	Process	Negative regulation of toll-like receptor 4 signaling pathway	NAS	15142865
GO:0034148	Process	Negative regulation of toll-like receptor 5 signaling pathway	IEA
GO:0035871	Process	Protein K11-linked deubiquitination	IDA	23827681
GO:0035872	Process	Nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway	TAS
GO:0039532	Process	Negative regulation of cytoplasmic pattern recognition receptor signaling pathway	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 25502805, 30561431, 31515488, 32296183
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	11463333, 15258597, 18223652, 21127049
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IEA
GO:0043130	Function	Ubiquitin binding	IPI	19285159
GO:0045732	Process	Positive regulation of protein catabolic process	IDA	21127049
GO:0045732	Process	Positive regulation of protein catabolic process	IEA
GO:0045732	Process	Positive regulation of protein catabolic process	IEA
GO:0045779	Process	Negative regulation of bone resorption	NAS	21127049
GO:0045824	Process	Negative regulation of innate immune response	IEA
GO:0045824	Process	Negative regulation of innate immune response	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IDA	16816117
GO:0050691	Process	Regulation of defense response to virus by host	NAS	15142865
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050728	Process	Negative regulation of inflammatory response	ISS
GO:0050869	Process	Negative regulation of B cell activation	IEA
GO:0050869	Process	Negative regulation of B cell activation	ISS
GO:0061043	Process	Regulation of vascular wound healing	NAS	16816117
GO:0061578	Function	K63-linked deubiquitinase activity	EXP	14748687
GO:0061578	Function	K63-linked deubiquitinase activity	TAS
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	ISS
GO:0070429	Process	Negative regulation of nucleotide-binding oligomerization domain containing 1 signaling pathway	IEA
GO:0070433	Process	Negative regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway	IEA
GO:0070530	Function	K63-linked polyubiquitin modification-dependent protein binding	IBA
GO:0070536	Process	Protein K63-linked deubiquitination	IDA	15258597
GO:0070536	Process	Protein K63-linked deubiquitination	IEA
GO:0070536	Process	Protein K63-linked deubiquitination	IEA
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	15258597
GO:0071108	Process	Protein K48-linked deubiquitination	IDA	23827681
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	19912257, 21127049, 21220427
GO:0071947	Process	Protein deubiquitination involved in ubiquitin-dependent protein catabolic process	IBA
GO:0072573	Process	Tolerance induction to lipopolysaccharide	IMP	21220427
GO:0072666	Process	Establishment of protein localization to vacuole	IEA
GO:0090291	Process	Negative regulation of osteoclast proliferation	NAS	21127049
GO:1901701	Process	Cellular response to oxygen-containing compound	IEA
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IDA	12167698
GO:2000347	Process	Positive regulation of hepatocyte proliferation	IEA
GO:2000349	Process	Negative regulation of CD40 signaling pathway	IMP	12885753
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IDA	12885753
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IEA

Other IDs

• MIM: 191163
• HGNC: 11896
• e!Ensembl: ENSG00000118503

Protein

• UniProt ID: P21580
• Protein name: Tumor necrosis factor alpha-induced protein 3 (TNF alpha-induced protein 3) (EC 2.3.2.-) (EC 3.4.19.12) (OTU domain-containing protein 7C) (Putative DNA-binding protein A20) (Zinc finger protein A20) [Cleaved into: A20p50; A20p37]
• Protein function: Ubiquitin-editing enzyme that contains both ubiquitin ligase and deubiquitinase activities. Involved in immune and inflammatory responses signaled by cytokines, such as TNF-alpha and IL-1 beta, or pathogens via Toll-like receptors (TLRs) through
• PDB: 2EQE, 2EQF, 2EQG, 2VFJ, 3DKB, 3OJ3, 3OJ4, 3VUW, 3VUX, 3VUY, 3ZJD, 3ZJE, 3ZJF, 3ZJG, 5LRX, 5V3B, 5V3P
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02338	OTU	98 → 257	OTU-like cysteine protease	Family
  PF01754	zf-A20	385 → 409	A20-like zinc finger	Family
  PF01754	zf-A20	476 → 500	A20-like zinc finger	Family
  PF01754	zf-A20	655 → 678	A20-like zinc finger	Family
  PF01754	zf-A20	760 → 784	A20-like zinc finger	Family

• Sequence:

  MAEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQF
  REIIHKALIDRNIQATLESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDL
  VLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTDTP
  MARSGLQYNSLEEIHIFVLCNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHWPA
  QECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDRGRFEDLKVHFLTDPENEMKE
  KLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENS
  EQGRREGHAQNPMEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNKLPK
  LNSKPGPEGLPGMALGASRGEAYEPLAWNPEESTGGPHSAPPTAPSPFLFSETTAMKCRS
  PGCPFTLNVQHNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCF
  KRTTAEASSSLSTSLPPSCHQRSKSDPSRLVRSPSPHSCHRAGNDAPAGCLSQAARTPGD
  RTGTSKCRKAGCVYFGTPENKGFCTLCFIEYRENKHFAAASGKVSPTASRFQNTIPCLGR
  ECGTLGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRPKCARAS
  CKNILACRSEELCMECQHPNQRMGPGAHRGEPAPEDPPKQRCRAPACDHFGNAKCNGYCN
  ECFQFKQMYG

• Sequence length: 790

Pathways

KEGG:

NF-kappa B signaling pathway
Necroptosis
NOD-like receptor signaling pathway
IL-17 signaling pathway
TNF signaling pathway
Measles
Epstein-Barr virus infection

Reactome:

NOD1/2 Signaling Pathway
TNFR1-induced proapoptotic signaling
Regulation of TNFR1 signaling
TNFR1-induced NFkappaB signaling pathway
Ovarian tumor domain proteases
Negative regulators of DDX58/IFIH1 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Autoinflammatory syndrome, familial, Behcet-like	Likely pathogenic; Pathogenic	rs1461832435, rs2114504458, rs2114496422, rs2114490906	RCV001329556 RCV001814603 RCV002244082 RCV003336786	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Autoinflammatory syndrome, familial, Behcet-like 1	Likely pathogenic; Pathogenic	rs2114501370, rs1423560438, rs2114499761, rs2114500822, rs752539001, rs370705859, rs2482743566, rs864321625, rs864321682, rs864321626, rs864321684, rs864321685, rs2482750192, rs2482727350, rs1776278098	RCV003147678 RCV003229628 RCV002508822 RCV002508823 RCV002283900 RCV002306235 RCV005863752 RCV002508765 RCV002508766 RCV002508767 RCV002508769 RCV002508770 RCV003224748 RCV003325259 RCV002508792	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
A20 haploinsufficiency	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS AND OTHER INFLAMMATORY SPONDYLOPATHIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EARLY-ONSET AUTOINFLAMMATORY SYNDROME DUE TO A20 HAPLOINSUFFICIENCY	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY SKIN DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA, FOLLICULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOSITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS VULGARIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIATIC ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SICCA SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGREN SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGREN'S SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGRENS SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog, Orphanet GWAS catalog, Orphanet GWAS catalog, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TNFAIP3-related disorder	Uncertain significance; Conflicting classifications of pathogenicity; Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Conflicting classifications of pathogenicity; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute pancreatitis	Pancreatitis	BEFREE	25050625		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	23327292		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	19380639, 28189285		★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	Pubtator	33679772	Associate	★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	26996111		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	37535999	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Pernicious	Pernicious anemia	Pubtator	33966343	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	21339218, 29940800, 31308453		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety	Anxiety Disorder	BEFREE	29486471		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29486471		★☆☆☆☆ Found in Text Mining only
Arthralgia	Arthralgia	Pubtator	33966343	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	19439038, 19774492		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	22087647, 25683200, 37535999	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	19565500, 19674979	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	22298274, 23054742, 31120955	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	37893484, 39991156	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17982455, 17982456, 19165918, 19292917, 19366996, 19417005, 19439038, 19445664, 19503088, 20112363, 20353580, 20483768, 20822710, 20849588, 20852893, 21326317, 22127930, 23450725, 23577190, 24884566, 25674272, 26143186, 33549125, 34433485, 34910834	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	25683200	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	20415816, 20875338, 26626624		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	18774390, 22694930, 28888782, 31381928		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	18774390, 22694930	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	38373824	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	31138864		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	19110536, 19412163, 20483768, 20511617, 20854658, 21088135, 21326317, 21723156, 21787353, 21833526, 23635951, 23944604, 24159176, 25302371, 25684197, 26092158, 26821284, 26846592, 26986245, 28448618, 29343543, 29440643, 29483615, 29515565, 29940800, 31138864, 31151831		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune disease	Pubtator	19565500, 20483768, 20854658, 21326317, 23944604, 24159176, 25806576, 26821284, 28448618, 29940800, 31138864, 31534975, 32231389, 33966343, 34030699, 35154120	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	CTD_human_DG	24453940		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune disease	Pubtator	31206174	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	BEFREE	27845235		★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	GENOMICS_ENGLAND_DG	29317407		★☆☆☆☆ Found in Text Mining only
Autoinflammatory disorder	Autoinflammatory Disease	GENOMICS_ENGLAND_DG	29317407		★☆☆☆☆ Found in Text Mining only
AUTOINFLAMMATORY SYNDROME, FAMILIAL, BEHCET-LIKE	Autoinflammatory Disease	GENOMICS_ENGLAND_DG	26642243, 29317407		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
AUTOINFLAMMATORY SYNDROME, FAMILIAL, BEHCET-LIKE	Autoinflammatory Disease	ORPHANET_DG	26642243		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
AUTOINFLAMMATORY SYNDROME, FAMILIAL, BEHCET-LIKE	Autoinflammatory Disease	UNIPROT_DG	26642243, 27175295		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
AUTOINFLAMMATORY SYNDROME, FAMILIAL, BEHCET-LIKE	Autoinflammatory Disease	BEFREE	31353537		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
AUTOINFLAMMATORY SYNDROME, FAMILIAL, BEHCET-LIKE	Autoinflammatory Disease	CTD_human_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
AUTOINFLAMMATORY SYNDROME, FAMILIAL, BEHCET-LIKE	Autoinflammatory Disease	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	19380639, 20533286, 21625233, 30301877		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	23161053, 24788730, 25405820, 26005883, 28582318, 30810840, 31164164, 31353537, 31376265		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	26642243, 26890122, 31164164, 31376265, 32719680, 33966343, 33971891, 34011076, 34030699, 34808442, 35154120, 37324276	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	25172408	Associate	★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	21127049	Associate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	33051914	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30166590, 31197211		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24833255	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29716623	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26485275	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26783726, 29033545	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27869168, 31452243		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	34071938	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	33578593, 36596765	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	19240061, 22113471		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	20483768	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	36064566	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	26592822, 32164735, 35856366	Associate	★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	31381928		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	26485275	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	22117534	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	20533286, 20669229		★☆☆☆☆ Found in Text Mining only
Chronic Lymphoproliferative Disorder of NK-Cells	Lymphoproliferative Disorder Of Natural Killer Cells	BEFREE	30859397		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	31138864		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29988117		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	20176734, 26062845, 28842689	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	27991929		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	37535999	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	29718933	Inhibit	★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	24099634	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22843550, 28842689, 29807108		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22843550, 29807108, 32671985, 36033828, 36129143	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24099634	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28842689	Inhibit	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	32047491	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	17259397		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	17259397, 25302371		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	20483768, 32164735	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	17259397		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	20176734, 21335489, 24776844, 25956706, 31626694		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	21326317, 36746519	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	25956706	Inhibit	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	26974007		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	Pubtator	18687424	Stimulate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	27286825	Inhibit	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	20822710		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	27640899, 29486471, 31307045		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	30118730		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	30543901	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	30118730		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	25337792	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	26652732		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	26652732		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28903990, 29696068	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	20176734, 20483768, 33966343, 35155683, 37324276	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	19110536, 20176734, 26652732		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17259397		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	20544211, 21324920, 22397314, 23327292, 23418597, 30301877		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	30118730		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Empyema Pleural	Emphysema	Pubtator	23418597	Inhibit	★☆☆☆☆ Found in Text Mining only
Epilepsies Partial	Partial epilepsy	Pubtator	31164164	Associate	★☆☆☆☆ Found in Text Mining only
Erythrokeratodermia Variabilis	Erythrokeratodermia variabilis	Pubtator	30543901	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	25354935, 26598072		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	25354935, 26598072		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27072986, 33374641	Associate	★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	30543901	Associate	★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	37893484	Associate	★☆☆☆☆ Found in Text Mining only
Familial Mediterranean Fever	Familial mediterranean fever	Pubtator	31376265	Associate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	30791746	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	29227477		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30336268		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	35580510	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	40138873	Associate	★☆☆☆☆ Found in Text Mining only
Generalized pustular psoriasis	Pustular Psoriasis	BEFREE	31353537		★☆☆☆☆ Found in Text Mining only
Genital ulcers	Genital ulcers	HPO_DG			★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	20231195		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16365179, 20186265, 24901050, 29274253		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19536297, 24901050	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	16365179, 20186265, 29274253		★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	35524416, 35813414	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	18814951	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	20049410		★☆☆☆☆ Found in Text Mining only
Granulomatous Slack Skin	Granulomatous Slack Skin	CTD_human_DG	26192916		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	24684463, 24798189	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	24798189		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	33966343, 34840214	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	34344926	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	37839544	Associate	★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	29202196		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	22087647	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	26518771	Associate	★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	28630090	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	28448618, 31138864	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	28784141	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	25890346, 28784141	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	26382585	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	31337730	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	33966343	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Autoinflammatory Diseases	Autoinflammatory Disease	CTD_human_DG	26642243		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	35937947	Associate	★☆☆☆☆ Found in Text Mining only
	Hereditary Pediatric Behcet-Like Disease	Orphanet			★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	19380636, 19380639, 28189285		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	19380639, 19648161, 23039325, 26650888, 31816062, 32079702	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	23418597	Inhibit	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	CGI_DG			★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	35446883	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	21740805		★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	36064566	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19536297	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	25337792		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	25674272		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	25890346, 26996111, 35486341	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	29327472		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	17805211, 20483768, 31299923	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29248493, 29788367		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	30118730		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	33226960	Stimulate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	32719680	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	26592822		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	19565500, 26305060		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	22525270		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	31534975	Associate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	21740805		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	26199174		★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	28115367		★☆☆☆☆ Found in Text Mining only
Libman-Sacks Disease	Nonbacterial verrucal endocardiosis	CTD_human_DG	19165918, 19165919, 19838193, 21336280		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25333455, 29190981, 31134613		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	31134613, 31138864		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	26681923, 28784141, 33966343	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	30446523		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	25337792, 31299923	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26367773	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	26092158		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19165918, 19165919, 19292917, 19439038, 20112363, 20169177, 20483768, 20617138, 20849588, 21336280, 21905002, 22087647, 24023622, 24039598, 26110642, 26821284, 31534975, 32334614, 32443356, 33679772, 34011076, 34847931, 35120571, 35710306, 38360126	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	26092158		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	19110536, 19165918, 19165919, 19292917, 19439038, 19774492, 20112363, 20483768, 20849588, 21208380, 21336280, 21905002, 22087647, 22488580, 22924496, 24023622, 24039598, 24489017, 25302371, 26092158, 26110642, 26821284, 26846592, 27659348, 27726311, 28158872, 29783072, 30041578, 30341420, 30529365, 31032751, 31625129		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	CTD_human_DG	19165918, 19165919, 19838193, 21336280		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASDB_DG	19165918, 19838193, 23273568		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	19165918, 19838193, 19838195, 23273568, 26663301, 27399966, 28714469		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	19165919		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	ORPHANET_DG	20617138, 21336280, 22654485, 23943494, 24039598, 24091983		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Nephritis	Lupus Nephritis	BEFREE	26110642, 29589214, 31811410		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	26110642	Inhibit	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	26092158		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26485275, 36033828	Associate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	36064566	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	19380636, 23418597, 23901138, 24159176, 26338037, 26986245		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	22808296, 24159176, 25991819, 26679293, 31534975, 33025009, 33311649, 34840214	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	23418597, 25856582	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	24362818	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Extranodal NK-T-Cell	Lymphoma	BEFREE	29380463		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	CTD_human_DG	24362818		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma, Follicular	Lymphoma	BEFREE	31807922		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma, Follicular, Grade 1	Lymphoma	CTD_human_DG	24362818		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular, Grade 2	Lymphoma	CTD_human_DG	24362818		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular, Grade 3	Lymphoma	CTD_human_DG	24362818		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	CTD_human_DG	24362818		★☆☆☆☆ Found in Text Mining only
Lymphoma, Mixed-Cell, Follicular	Lymphoma	CTD_human_DG	24362818		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	30301877		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	30301877		★☆☆☆☆ Found in Text Mining only
Lymphoma, Small Cleaved-Cell, Follicular	Lymphoma	CTD_human_DG	24362818		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	CTD_human_DG	26192916		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	23418597		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	27640899, 29486471, 29898456		★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Cortical development malformation	Pubtator	33051914	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30166590, 31197211		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	25354935, 26598072		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27869168, 31452243		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20669229, 21625233, 23039325, 25856582, 31134613		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	GWASCAT_DG	29299148		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	27991929		★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	17886247, 19608751, 23418597, 27248180, 28152507		★☆☆☆☆ Found in Text Mining only
Mediastinal (Thymic) Large B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	30211726		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	34772393	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27640899, 29486471, 31307045		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	29696068	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	25405820		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	17886247, 19608751, 23418597, 24159176, 28152507, 28682481, 28892161		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	LHGDN	17886247		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	20574050, 25856582, 26518771	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	25856582		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	22190364		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	CTD_human_DG	24076602		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	24852325, 25684197		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	24852325, 26062845, 33051914	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis, Acute Fulminating	Multiple Sclerosis	CTD_human_DG	24076602		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	23049601, 28514294	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	28514294		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	38511647	Inhibit	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	35558073	Stimulate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	37839544	Associate	★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	25728713		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	25337792	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	33530452	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Type Extranodal NK/T-Cell Lymphoma	Extranodal NK T Cell Lymphoma	BEFREE	31140551		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	27647909, 27919278, 28253718		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	28013313		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17886247, 18181176, 19258598, 19380639, 19608751, 21088135, 21625233, 21763284, 22843550, 23901138, 26366710, 26768118, 27991929, 28153771, 29233925, 30111373, 31134613, 31807922		★☆☆☆☆ Found in Text Mining only
Neuropsychiatric Systemic Lupus Erythematosus	Neuropsychiatric Systemic Lupus Erythematosus	BEFREE	31625129		★☆☆☆☆ Found in Text Mining only
Nodular Lymphocyte Predominant Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	19648161		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29227477		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31452243		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	29227477		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	30111373		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	37252693	Associate	★☆☆☆☆ Found in Text Mining only
Oligoarticular Juvenile Idiopathic Arthritis	Oligoarticular Arthritis	BEFREE	19565500		★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	23884832, 33782454, 37986345	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	34910834	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37342083	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36596765	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	25050625	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	36918862	Stimulate	★☆☆☆☆ Found in Text Mining only
Pauci-immune Glomerulonephritis associated with Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	BEFREE	20049410		★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	Pubtator	33966343	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	34092220	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	23824412		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	35025147	Inhibit	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	25337792		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	25337792	Associate	★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	20544211		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15862966		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	19169254		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASCAT_DG	19169254, 20953190, 23143594, 25574825, 25903422, 26626624, 26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASDB_DG	19169254, 20953187, 20953190, 23143594		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	CTD_human_DG	19169254, 20953190		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	19169254, 20483768, 21326317, 22298274, 23054742, 26613086, 29696068, 30543901, 37893484	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	19262574, 19446472, 20415816, 20480402, 21362769, 22113471, 23054742, 23521149, 25182136, 25264125, 25406098, 25496073, 26046540, 26613086, 26626624, 26738398, 26780035, 27364786, 27564082, 28658319, 30118730, 31120955		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	23054742, 25406098, 25496073, 29031612, 30341420		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis vulgaris	Psoriasis vulgaris	GWASCAT_DG	26626624		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pustular psoriasis	Pustular Psoriasis	BEFREE	27364786		★☆☆☆☆ Found in Text Mining only
Pustulosis of Palms and Soles	Palmoplantar Pustules	CTD_human_DG	19169254, 20953190		★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	19902201		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17982456, 19110536, 19165918, 19292917, 19439038, 20112363, 20192992, 20353580, 20483768, 20822710, 20849588, 20852893, 21120996, 21362769, 21833526, 22113471, 22127930, 22129793, 22402800, 23450725, 24489017, 24884566, 25674272, 25683200, 25684197, 27779104, 28199970, 28888761, 29853534		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	18794853, 20453842, 21841782, 23143596, 30224649		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	22446963, 23143596		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis Allergic	Rhinitis	Pubtator	26996111	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	29801054	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	28526340		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	21769840, 23124809	Associate	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	21625233, 28296250		★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	CTD_human_DG	24097066, 24097067		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sjogren's Syndrome	Sjogren syndrome	Pubtator	21326317, 24097067, 24159176, 26679293, 26724675, 29655283, 30662920, 31534975, 35896530, 40298889	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sjogren`s Syndrome	Sjogren`s Syndrome	GWASCAT_DG	24097066		★☆☆☆☆ Found in Text Mining only
Sjogren`s Syndrome	Sjogren`s Syndrome	GWASDB_DG	24097066		★☆☆☆☆ Found in Text Mining only
Sjogren`s Syndrome	Sjogren`s Syndrome	CTD_human_DG	24097066, 24097067		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	32176034	Associate	★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	28791018		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	29940800, 31308453	Associate	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	31206174	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28197630		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34878732	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31153693		★☆☆☆☆ Found in Text Mining only
Stomatitis Aphthous	Aphthous stomatitis	Pubtator	33966343	Associate	★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	22129793		★☆☆☆☆ Found in Text Mining only
Systemic lupus erythematosus	Systemic lupus erythematosus	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	BEFREE	20511617, 21769840, 22488580, 23124809, 26474180, 28434122, 28526340		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	GWASCAT_DG	28314753		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
T-Cell Large Granular Lymphocyte Leukemia	T-cell Lymphocytic Leukemia	BEFREE	26199174		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	28514294		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroiditis Autoimmune	Thyroiditis	Pubtator	24798189	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30166590		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	20176734, 24776844, 28842689		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	27640899, 29486471		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	32975231	Associate	★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	23555688, 24788730		★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic syndrome	Pubtator	23555688	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	21754991	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	19351844, 30301877	Associate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	30301877		★☆☆☆☆ Found in Text Mining only