TMPRSS2 (transmembrane serine protease 2)

Gene

• Entrez ID: 7113
• Gene name: Transmembrane serine protease 2
• Gene symbol: TMPRSS2
• Synonyms (NCBI Gene): PRSS10
• Chromosome: 21
• Chromosome location: 21q22.3
• Summary: This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a type II transmembrane domain, a receptor class A domain, a scavenger receptor cysteine-rich domain and a protease domain. Serine proteases are known to

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT734703	hsa-miR-98-5p	qRT-PCR	33359190
MIRT734704	hsa-miR-32-3p	qRT-PCR	33359190
MIRT734705	hsa-miR-214-3p	qRT-PCR	33359190
MIRT1441037	hsa-miR-182	CLIP-seq
MIRT1441038	hsa-miR-3130-3p	CLIP-seq
MIRT1441039	hsa-miR-3173-5p	CLIP-seq
MIRT1441040	hsa-miR-330-3p	CLIP-seq
MIRT1441041	hsa-miR-361-3p	CLIP-seq
MIRT1441042	hsa-miR-362-5p	CLIP-seq
MIRT1441043	hsa-miR-3665	CLIP-seq
MIRT1441044	hsa-miR-3679-3p	CLIP-seq
MIRT1441045	hsa-miR-3682-3p	CLIP-seq
MIRT1441046	hsa-miR-3944-5p	CLIP-seq
MIRT1441047	hsa-miR-4253	CLIP-seq
MIRT1441048	hsa-miR-4279	CLIP-seq
MIRT1441049	hsa-miR-4433	CLIP-seq
MIRT1441050	hsa-miR-4470	CLIP-seq
MIRT1441051	hsa-miR-4688	CLIP-seq
MIRT1441052	hsa-miR-4691-5p	CLIP-seq
MIRT1441053	hsa-miR-4717-5p	CLIP-seq
MIRT1441054	hsa-miR-4722-3p	CLIP-seq
MIRT1441055	hsa-miR-4733-3p	CLIP-seq
MIRT1441056	hsa-miR-4755-3p	CLIP-seq
MIRT1441057	hsa-miR-4758-3p	CLIP-seq
MIRT1441058	hsa-miR-500b	CLIP-seq
MIRT1441059	hsa-miR-550b	CLIP-seq
MIRT1441060	hsa-miR-646	CLIP-seq
MIRT1441061	hsa-miR-657	CLIP-seq
MIRT1441062	hsa-miR-665	CLIP-seq
MIRT1441063	hsa-miR-767-5p	CLIP-seq
MIRT1441064	hsa-miR-769-5p	CLIP-seq
MIRT1441065	hsa-miR-890	CLIP-seq
MIRT1441066	hsa-let-7a	CLIP-seq
MIRT1441067	hsa-let-7b	CLIP-seq
MIRT1441068	hsa-let-7c	CLIP-seq
MIRT1441069	hsa-let-7d	CLIP-seq
MIRT1441070	hsa-let-7e	CLIP-seq
MIRT1441071	hsa-let-7f	CLIP-seq
MIRT1441072	hsa-let-7g	CLIP-seq
MIRT1441073	hsa-let-7i	CLIP-seq
MIRT1441074	hsa-miR-185	CLIP-seq
MIRT1441075	hsa-miR-202	CLIP-seq
MIRT1441076	hsa-miR-3144-5p	CLIP-seq
MIRT1441077	hsa-miR-3145-3p	CLIP-seq
MIRT1441078	hsa-miR-3180-5p	CLIP-seq
MIRT1441079	hsa-miR-3191	CLIP-seq
MIRT1441080	hsa-miR-3908	CLIP-seq
MIRT1441081	hsa-miR-3929	CLIP-seq
MIRT1441082	hsa-miR-3942-5p	CLIP-seq
MIRT1441083	hsa-miR-4306	CLIP-seq
MIRT1441084	hsa-miR-4419b	CLIP-seq
MIRT1441085	hsa-miR-4458	CLIP-seq
MIRT1441086	hsa-miR-4478	CLIP-seq
MIRT1441087	hsa-miR-4500	CLIP-seq
MIRT1441088	hsa-miR-4505	CLIP-seq
MIRT1441089	hsa-miR-4644	CLIP-seq
MIRT1441090	hsa-miR-4652-5p	CLIP-seq
MIRT1441091	hsa-miR-4667-5p	CLIP-seq
MIRT1441092	hsa-miR-4700-5p	CLIP-seq
MIRT1441093	hsa-miR-4703-5p	CLIP-seq
MIRT1441094	hsa-miR-4731-5p	CLIP-seq
MIRT1441095	hsa-miR-4752	CLIP-seq
MIRT1441096	hsa-miR-4766-3p	CLIP-seq
MIRT1441097	hsa-miR-4803	CLIP-seq
MIRT1441098	hsa-miR-494	CLIP-seq
MIRT1441099	hsa-miR-579	CLIP-seq
MIRT1441100	hsa-miR-664	CLIP-seq
MIRT1441062	hsa-miR-665	CLIP-seq
MIRT1441101	hsa-miR-98	CLIP-seq
MIRT1441066	hsa-let-7a	CLIP-seq
MIRT1441067	hsa-let-7b	CLIP-seq
MIRT1441068	hsa-let-7c	CLIP-seq
MIRT1441069	hsa-let-7d	CLIP-seq
MIRT1441070	hsa-let-7e	CLIP-seq
MIRT1441071	hsa-let-7f	CLIP-seq
MIRT1441072	hsa-let-7g	CLIP-seq
MIRT1441073	hsa-let-7i	CLIP-seq
MIRT2132064	hsa-miR-140-3p	CLIP-seq
MIRT2132065	hsa-miR-3202	CLIP-seq
MIRT2132066	hsa-miR-4310	CLIP-seq
MIRT1441085	hsa-miR-4458	CLIP-seq
MIRT2132067	hsa-miR-4475	CLIP-seq
MIRT1441087	hsa-miR-4500	CLIP-seq
MIRT2132068	hsa-miR-4533	CLIP-seq
MIRT1441060	hsa-miR-646	CLIP-seq
MIRT1441101	hsa-miR-98	CLIP-seq
MIRT2353176	hsa-miR-2277-3p	CLIP-seq
MIRT2353177	hsa-miR-542-3p	CLIP-seq
MIRT1441060	hsa-miR-646	CLIP-seq
MIRT1441066	hsa-let-7a	CLIP-seq
MIRT1441067	hsa-let-7b	CLIP-seq
MIRT1441068	hsa-let-7c	CLIP-seq
MIRT1441069	hsa-let-7d	CLIP-seq
MIRT1441070	hsa-let-7e	CLIP-seq
MIRT1441071	hsa-let-7f	CLIP-seq
MIRT1441072	hsa-let-7g	CLIP-seq
MIRT1441073	hsa-let-7i	CLIP-seq
MIRT1441085	hsa-miR-4458	CLIP-seq
MIRT1441087	hsa-miR-4500	CLIP-seq
MIRT1441060	hsa-miR-646	CLIP-seq
MIRT1441101	hsa-miR-98	CLIP-seq
MIRT1441066	hsa-let-7a	CLIP-seq
MIRT1441067	hsa-let-7b	CLIP-seq
MIRT1441068	hsa-let-7c	CLIP-seq
MIRT1441069	hsa-let-7d	CLIP-seq
MIRT1441070	hsa-let-7e	CLIP-seq
MIRT1441071	hsa-let-7f	CLIP-seq
MIRT1441072	hsa-let-7g	CLIP-seq
MIRT1441073	hsa-let-7i	CLIP-seq
MIRT1441085	hsa-miR-4458	CLIP-seq
MIRT1441087	hsa-miR-4500	CLIP-seq
MIRT2396078	hsa-miR-596	CLIP-seq
MIRT2396079	hsa-miR-939	CLIP-seq
MIRT1441101	hsa-miR-98	CLIP-seq
MIRT2646811	hsa-miR-3176	CLIP-seq
MIRT2646812	hsa-miR-3922-3p	CLIP-seq
MIRT2646813	hsa-miR-4446-3p	CLIP-seq
MIRT2646814	hsa-miR-4639-5p	CLIP-seq
MIRT2646815	hsa-miR-4685-5p	CLIP-seq
MIRT2646816	hsa-miR-4701-5p	CLIP-seq
MIRT2646817	hsa-miR-588	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
AR	Activation	20308527;21761340
AR	Unknown	23192983
ERG	Unknown	24418414
NKX3-1	Unknown	24418414

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IDA	25122198
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	TAS
GO:0005515	Function	Protein binding	IPI	21068237, 32296183, 33741941
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	21068237
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9325052
GO:0006508	Process	Proteolysis	IDA	21068237, 24227843
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IBA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	TAS	9325052
GO:0016020	Component	Membrane	IEA
GO:0016540	Process	Protein autoprocessing	IBA
GO:0016540	Process	Protein autoprocessing	IMP	21068237
GO:0016787	Function	Hydrolase activity	IEA
GO:0019081	Process	Viral translation	TAS	27384577
GO:0046598	Process	Positive regulation of viral entry into host cell	IDA	21068237, 24227843, 32404436
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 23533145
GO:0098670	Process	Entry receptor-mediated virion attachment to host cell	IDA	32142651

Other IDs

• MIM: 602060
• HGNC: 11876
• e!Ensembl: ENSG00000184012

Protein

• UniProt ID: O15393
• Protein name: Transmembrane protease serine 2 (EC 3.4.21.122) (Serine protease 10) [Cleaved into: Transmembrane protease serine 2 non-catalytic chain; Transmembrane protease serine 2 catalytic chain]
• Protein function: Plasma membrane-anchored serine protease that cleaves at arginine residues (PubMed:32703818, PubMed:35676539, PubMed:37990007, PubMed:38964328). Participates in proteolytic cascades of relevance for the normal physiologic function of the prostat
• PDB: 7MEQ, 7XYD, 7Y0E, 7Y0F, 8HD8, 8JHZ, 8JI0, 8S0L, 8S0M, 8S0N, 8V04, 8V1F, 8VGT, 8Y1D, 8Y1E, 8Y7X, 8Y7Y, 8Y87, 8Y88, 8Y89, 8Y8A, 8Y8B, 8YOY, 8YQQ, 9IZN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15494	SRCR_2	153 → 248	Scavenger receptor cysteine-rich domain	Domain
  PF00089	Trypsin	256 → 484	Trypsin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in several tissues that comprise large populations of epithelial cells with the highest level of transcripts measured in the prostate gland. Expressed in type II pneumocytes in the lung (at protein level). Expressed strongly
• Sequence:

  MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQA
  SNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIEC
  DSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENY
  GRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLR
  CIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEK
  PLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDL
  VKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLI
  TPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVF
  TDWIYRQMRADG

• Sequence length: 492

Pathways

KEGG:

Influenza A
Coronavirus disease - COVID-19
Transcriptional misregulation in cancer
Prostate cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Associated with severe COVID-19 disease	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER PAIN	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPTIC ATROPHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TMPRSS2-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	11745466, 19151660, 20736744, 21040948		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	16575875, 17804708		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	17804708, 18338334, 19734849, 21499238, 31732966		★☆☆☆☆ Found in Text Mining only
amyloidosis IX	Amyloidosis	Pubtator	30300367	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	20478527		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	37142998	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	23130941, 28050800, 30042415		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	32348692, 32422146, 33413387, 34198852	Associate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	11745466, 18338334, 20616363, 22674214, 24961351		★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	31638934		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	34416267	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25029565, 30792990, 36364238	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33421977	Stimulate	★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	17259299, 21178489, 24115221	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17032499, 18474293, 19465903, 20736744, 24469092, 25894226, 30656528		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22430804	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	21499238	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	32468052	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	32492203, 35170548	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	32468052	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	32970391	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	32468052, 34257580	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	33421977	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17367471		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32675312, 34257580	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	17334343, 17485299		★☆☆☆☆ Found in Text Mining only
Congenital thrombotic disease due to Protein C deficiency	Congenital thrombotic thrombocytopenic purpura	Pubtator	24469092, 37847647	Associate	★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	33488517	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	33156843	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	32668165	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	32348692, 34417262	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	32970391, 33254575	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	10207158, 33479353	Associate	★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	19151660, 19465903		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	35636966	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	32468052, 33061814	Associate	★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	18794177		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	36125178	Associate	★☆☆☆☆ Found in Text Mining only
Essential Tremor	Essential tremor	Pubtator	34953136	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	23940108		★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	17527075, 19029822, 20735386, 22038307, 22855165, 24186205, 25749044, 26070514, 27271990, 30367117		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	35104687	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	33707526, 35970857	Associate	★☆☆☆☆ Found in Text Mining only
Genetic Predisposition to Disease	Genetic predisposition to disease	Pubtator	32492203	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	36362417	Inhibit	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	32967703	Associate	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	10207158	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	35996506	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	25203900	Associate	★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	36125178	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29163372		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	35996506	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	34416267	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	34204705	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	33156843, 34697723	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	35366343	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	33061814	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31854219, 32967703, 34168096, 35170548, 36565756, 38063850	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35017320	Inhibit	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31491926		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11245484, 11745466, 15065083, 16254181, 16585160, 16951139, 16951141, 16983328, 17043636, 17059688, 17079440, 17108102, 17172822, 17237811, 17259299, 17334343, 17334351, 17385188, 17390040, 17401460, 17632455, 17637754, 17654723, 17671502, 17679089, 17785564, 17971772, 18065961, 18165275, 18172298, 18283340, 18338334, 18422767, 18451133, 18483239, 18500259, 18519767, 18519769, 18542058, 18676740, 18694509, 18781147, 18794177, 18798265, 18948370, 19029822, 19066166, 19136943, 19147579, 19176386, 19190343, 19205910, 19242826, 19339269, 19395877, 19396154, 19396167, 19396168, 19409690, 19520778, 19584163, 19584279, 19642730, 19647299, 19664128, 19716227, 19825963, 19861517, 19933109, 20014889, 20068566, 20118910, 20160063, 20303538, 20473283, 20478527, 20562851, 20616363, 20651988, 20687225, 20693979, 20713528, 20735386, 20736744, 20800881, 20878952, 20947519, 21036922, 21040948, 21169414, 21258770, 21499236, 21499238, 21519790, 21572435, 21600800, 21676887, 21707704, 21743434, 21747944, 21791629, 21796535, 21813756, 21814574, 21937078, 21946329, 21993862, 22142399, 22154085, 22245323, 22415461, 22424448, 22452941, 22505341, 22674214, 22695242, 22736790, 22821757, 22821767, 22855165, 22860005, 22993300, 23018874, 23052253, 23201468, 23213079, 23244085, 23267145, 23319146, 23334893, 23352841, 23357671, 23370768, 23381693, 23426182, 23433128, 23447416, 23472063, 23478499, 23480797, 23535644, 23555854, 23565244, 23578236, 23701505, 23708657, 23728339, 23781502, 23913826, 23918607, 23918819, 23996639, 24072184, 24115221, 24133629, 24142545, 24149465, 24186205, 24211598, 24266818, 24297949, 24378408, 24488012, 24510842, 24659477, 24762546, 24768356, 24777847, 24815454, 24824408, 24909781, 24925673, 24926821, 24961351, 25007891, 25015038, 25040002, 25088707, 25175909, 25252136, 25263440, 25266362, 25367948, 25547910, 25749044, 25754347, 25794974, 25852077, 25897494, 25915538, 25933120, 25972242, 25973080, 25977336, 26018085, 26070514, 26294063, 26310325, 26392259, 26411452, 26424596, 26503111, 26575822, 26774207, 26857646, 26880803, 26935606, 26959281, 26987799, 27185499, 27223260, 27299694, 27375789, 27377958, 27470540, 27500376, 27562498, 27728977, 27753122, 27771128, 27798103, 27865106, 27910803, 27926866, 28004109, 28050800, 28055969, 28061466, 28102015, 28189568, 28382513, 28445989, 28545426, 28591703, 28633309, 28652740, 28845585, 28849022, 28917266, 28986382, 29127096, 29163372, 29167279, 29277318, 29345891, 29346775, 29392925, 29453313, 29581856, 29712692, 29727181, 29773553, 29786791, 29844131, 30042415, 30078722, 30108097, 30150711, 30195632, 30201302, 30241953, 30260630, 30294801, 30301696, 30363496, 30367117, 30510458, 30656528, 30718921, 30892142, 30900303, 31090091, 31194651, 31308362, 31421692, 31447885, 31614005		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	18798265, 25735316, 28783165, 29610475		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11245484, 16983328, 17079440, 17385188, 17527075, 18338334, 19029822, 20124490, 20562851, 20601956, 20616363, 20693982, 21600800, 21813756, 24504051, 25015038, 25794974, 25894226, 26210103, 26764246, 26857646, 27328849, 27707886, 28520829, 30892142, 31308362		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	30792990	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	18483239, 18694509, 21937078		★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	19465903		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	33210729	Inhibit	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16951139, 17390040, 17804708, 18166163, 18338334, 19190343, 19242826, 19396168, 19825963, 20068566, 20160063, 20562851, 20693982, 20736744, 21394739, 21802835, 21813756, 22313860, 22424448, 22505341, 22736790, 22930729, 23052253, 23201468, 23204237, 23558555, 23728339, 24195515, 24762546, 24909781, 24926821, 25007891, 25175909, 25252136, 25266362, 25754347, 25852077, 25906751, 25913390, 25939480, 26018085, 26310325, 26459268, 26575822, 26684029, 26752304, 26880803, 27391263, 27626314, 27630329, 27771128, 28050800, 28633309, 29127096, 29167279, 29773553, 30367117, 30430607, 30718921, 30807643, 31090091, 31296150, 31382165, 31638934		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	34834998	Associate	★☆☆☆☆ Found in Text Mining only
Nijmegen Breakage Syndrome	Nijmegen Breakage Syndrome	BEFREE	24510842		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	28598696		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24292212, 29167279	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	25852077, 27771128, 29163372, 29167279		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34951103	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31491926		★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	35104687	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	32412125	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11245484, 11745466, 15065083, 16254181, 16585160, 16951139, 16951141, 16983328, 17059688, 17079440, 17172822, 17237811, 17334343, 17334351, 17385188, 17390040, 17401460, 17632455, 17637754, 17654723, 17785564, 18065961, 18165275, 18172298, 18283340, 18338334, 18422767, 18451133, 18483239, 18500259, 18519767, 18519769, 18542058, 18676740, 18694509, 18794177, 18948370, 19029822, 19136943, 19147579, 19242826, 19395877, 19396154, 19396168, 19409690, 19520778, 19584163, 19584279, 19642730, 19647299, 19664128, 19716227, 19825963, 19861517, 20014889, 20068566, 20118910, 20160063, 20303538, 20473283, 20478527, 20562851, 20616363, 20687225, 20693979, 20713528, 20735386, 20736744, 20800881, 20878952, 20947519, 21036922, 21169414, 21499238, 21519790, 21572435, 21600800, 21707704, 21743434, 21747944, 21946329, 21993862, 22142399, 22154085, 22245323, 22415461, 22424448, 22452941, 22505341, 22674214, 22695242, 22736790, 22821757, 22821767, 22855165, 22860005, 22993300, 23018874, 23052253, 23201468, 23213079, 23267145, 23319146, 23334893, 23352841, 23357671, 23370768, 23426182, 23433128, 23447416, 23472063, 23478499, 23480797, 23535644, 23555854, 23565244, 23578236, 23701505, 23708657, 23728339, 23781502, 23850495, 23918607, 23918819, 23996639, 24072184, 24133629, 24142545, 24149465, 24186205, 24211598, 24266818, 24297949, 24378408, 24488012, 24510842, 24659477, 24762546, 24768356, 24777847, 24815454, 24824408, 24909781, 24925673, 24926821, 24961351, 25007891, 25015038, 25040002, 25088707, 25175909, 25252136, 25263440, 25266362, 25367948, 25547910, 25749044, 25754347, 25852077, 25897494, 25915538, 25933120, 25973080, 25977336, 26018085, 26070514, 26294063, 26310325, 26411452, 26424596, 26503111, 26575822, 26670747, 26774207, 26857646, 26880803, 26935606, 26959281, 26987799, 27223260, 27299694, 27375789, 27377958, 27470540, 27500376, 27562498, 27728977, 27753122, 27771128, 27798103, 27865106, 27910803, 28004109, 28050800, 28055969, 28061466, 28102015, 28189568, 28382513, 28445989, 28545426, 28591703, 28633309, 28652740, 28845585, 28849022, 28917266, 28986382, 29127096, 29163372, 29167279, 29277318, 29345891, 29346775, 29392925, 29453313, 29712692, 29773553, 29786791, 29844131, 30042415, 30108097, 30195632, 30201302, 30241953, 30260630, 30294801, 30301696, 30363496, 30367117, 30510458, 30656528, 30718921, 30892142, 30900303, 31090091, 31194651, 31308362, 31421692, 31447885		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Diseases	Prostatic Diseases	BEFREE	28102015		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	18338334, 23887154		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	32412125, 35821619	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	17032499, 24297949, 27272561	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	LHGDN	18519767		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	19396167, 20736744, 24961351		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	11245484, 18676740, 19597533, 20736744, 23321466, 23535644, 24925673, 25088707, 25753984, 25939480, 26751641, 27626314, 27753122, 27814612, 28598696, 28783165, 31303963		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15537383, 16820092, 16983328, 17059688, 17079440, 17172822, 17259299, 17334343, 17334351, 17385188, 17401460, 17632455, 17637754, 17679089, 17971772, 17991527, 18165275, 18245462, 18385909, 18483239, 18500259, 18505969, 18694509, 18719366, 18794177, 18948370, 19029822, 19136943, 19190343, 19205910, 19293179, 19396154, 19584163, 19597533, 19647299, 19649210, 19933109, 20068566, 20118910, 20473283, 20478527, 20516122, 20616363, 20693979, 20735386, 20947519, 21036922, 21178489, 21378318, 21499236, 21499238, 21600800, 21669963, 21937078, 21969603, 22080055, 22123976, 22349460, 22642898, 22899295, 23086769, 23148372, 23244085, 23251544, 23272087, 23341502, 23381693, 23384557, 23447416, 23459095, 23480797, 23535644, 23555854, 23565244, 23661613, 23701505, 23781502, 23913826, 23918819, 23940108, 24098661, 24115221, 24186205, 24292212, 24297949, 24504521, 24762546, 24815454, 24824408, 24925673, 25007891, 25175909, 25201530, 25266362, 25728532, 25754347, 25829060, 25897494, 25915538, 25969144, 25972242, 25977336, 25985884, 26310325, 26344095, 26344096, 26503111, 26575822, 26623558, 26752304, 26941365, 26986253, 26990456, 27012192, 27127882, 27144529, 27223260, 27271990, 27320318, 27328849, 27375789, 27377958, 27470540, 27500376, 27562498, 27753122, 27798103, 27906189, 27926866, 28050800, 28102015, 28445989, 28545426, 28652740, 28849022, 28887309, 29167279, 29181411, 29346775, 29949537, 30150711, 30190183, 30301696, 30339521, 30367117, 30892142, 30901730, 31043167, 31308362, 31405024, 31616062, 31779479, 31915468, 32123273, 32229180, 32313185, 32343676, 32387456, 32412125, 32417965, 32573479, 32978525, 33141952, 33303959, 33375616, 33609069, 33627383, 33771697, 34341114, 34692848, 34792282, 35220606, 35513774, 35943799, 36125519, 36364238, 36443337, 36576468, 36622760, 36834705, 37300660, 37477913, 37847647, 37878968, 37960954, 38477088, 38522124, 39190349, 39741346	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16585160, 16820092, 17390040, 17584912, 17632455, 17654723, 18065961, 18172298, 18385909, 18483239, 18519767, 18519769, 18676740, 18694509		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	18798265, 25735316, 28783165, 29610475		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	33978304, 34051791, 35549656	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	34951103	Associate	★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	27144529		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	32422146	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	36364238	Associate	★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	24227843, 27733646, 28778717, 30626688		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	19465903, 21040948, 21499238, 23850495, 24777847		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31217847		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32967703	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34719202	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34840985	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	32970391	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	36362417	Inhibit	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	36364238	Associate	★☆☆☆☆ Found in Text Mining only