Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7101
Gene name	Nuclear receptor subfamily 2 group E member 1
Gene symbol	NR2E1
Synonyms (NCBI Gene)	TLLTLXXTLL
Chromosome	6
Chromosome location	6q21
Summary	The protein encoded by this gene is an orphan receptor involved in retinal development. The encoded protein also regulates adult neural stem cell proliferation and may be involved in control of aggressive behavior. Two transcript variants encoding differe

196

Show/Hide all (196)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004618	hsa-let-7b-5p	immunoblotLuciferase reporter assayNorthern blotWestern blot	20133835
MIRT004982	hsa-miR-9-5p	GFP reporter assayImmunocytochemistryImmunoprecipitaionLuciferase reporter assayNorthern blotqRT-PCRWestern blot	19330006
MIRT004982	hsa-miR-9-5p	GFP reporter assayImmunocytochemistryImmunoprecipitaionLuciferase reporter assayNorthern blotqRT-PCRWestern blot	19330006
MIRT004982	hsa-miR-9-5p	GFP reporter assayImmunocytochemistryImmunoprecipitaionLuciferase reporter assayNorthern blotqRT-PCRWestern blot	19330006
MIRT004982	hsa-miR-9-5p	GFP reporter assayImmunocytochemistryImmunoprecipitaionLuciferase reporter assayNorthern blotqRT-PCRWestern blot	19330006
MIRT029877	hsa-miR-26b-5p	Microarray	19088304
MIRT608869	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT608870	hsa-miR-124-5p	HITS-CLIP	23824327
MIRT608868	hsa-miR-1206	HITS-CLIP	23824327
MIRT608867	hsa-miR-6853-3p	HITS-CLIP	23824327
MIRT608866	hsa-miR-1298-5p	HITS-CLIP	23824327
MIRT608864	hsa-miR-4455	HITS-CLIP	23824327
MIRT608865	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT625927	hsa-miR-3922-5p	HITS-CLIP	23824327
MIRT608869	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT608870	hsa-miR-124-5p	HITS-CLIP	23824327
MIRT608868	hsa-miR-1206	HITS-CLIP	23824327
MIRT608867	hsa-miR-6853-3p	HITS-CLIP	23824327
MIRT625926	hsa-miR-561-5p	HITS-CLIP	23824327
MIRT608864	hsa-miR-4455	HITS-CLIP	23824327
MIRT608865	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT625927	hsa-miR-3922-5p	HITS-CLIP	23824327
MIRT608869	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT608870	hsa-miR-124-5p	HITS-CLIP	23824327
MIRT608868	hsa-miR-1206	HITS-CLIP	23824327
MIRT608867	hsa-miR-6853-3p	HITS-CLIP	23824327
MIRT625926	hsa-miR-561-5p	HITS-CLIP	23824327
MIRT608864	hsa-miR-4455	HITS-CLIP	23824327
MIRT608865	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT608869	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT608870	hsa-miR-124-5p	HITS-CLIP	23824327
MIRT608868	hsa-miR-1206	HITS-CLIP	23824327
MIRT608867	hsa-miR-6853-3p	HITS-CLIP	23824327
MIRT608866	hsa-miR-1298-5p	HITS-CLIP	23824327
MIRT608864	hsa-miR-4455	HITS-CLIP	23824327
MIRT608865	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT625927	hsa-miR-3922-5p	HITS-CLIP	23824327
MIRT608869	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT608870	hsa-miR-124-5p	HITS-CLIP	23824327
MIRT608868	hsa-miR-1206	HITS-CLIP	23824327
MIRT608867	hsa-miR-6853-3p	HITS-CLIP	23824327
MIRT625926	hsa-miR-561-5p	HITS-CLIP	23824327
MIRT608866	hsa-miR-1298-5p	HITS-CLIP	23824327
MIRT608864	hsa-miR-4455	HITS-CLIP	23824327
MIRT608865	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT608869	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT608870	hsa-miR-124-5p	HITS-CLIP	23824327
MIRT608868	hsa-miR-1206	HITS-CLIP	23824327
MIRT608867	hsa-miR-6853-3p	HITS-CLIP	23824327
MIRT608866	hsa-miR-1298-5p	HITS-CLIP	23824327
MIRT608864	hsa-miR-4455	HITS-CLIP	23824327
MIRT608865	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT608871	hsa-miR-3650	HITS-CLIP	24906430
MIRT608869	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT608870	hsa-miR-124-5p	HITS-CLIP	24906430
MIRT608868	hsa-miR-1206	HITS-CLIP	24906430
MIRT608867	hsa-miR-6853-3p	HITS-CLIP	24906430
MIRT608866	hsa-miR-1298-5p	HITS-CLIP	24906430
MIRT608864	hsa-miR-4455	HITS-CLIP	24906430
MIRT608865	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT535629	hsa-miR-6884-3p	PAR-CLIP	20371350
MIRT535628	hsa-miR-3121-5p	PAR-CLIP	20371350
MIRT535627	hsa-miR-3912-5p	PAR-CLIP	20371350
MIRT535626	hsa-miR-514a-3p	PAR-CLIP	20371350
MIRT535625	hsa-miR-514b-3p	PAR-CLIP	20371350
MIRT535623	hsa-miR-4646-3p	PAR-CLIP	20371350
MIRT535624	hsa-miR-2355-3p	PAR-CLIP	20371350
MIRT535635	hsa-miR-4662a-3p	PAR-CLIP	22012620
MIRT535634	hsa-miR-3925-5p	PAR-CLIP	22012620
MIRT535633	hsa-miR-3123	PAR-CLIP	22012620
MIRT535632	hsa-miR-3976	PAR-CLIP	22012620
MIRT535631	hsa-miR-6739-5p	PAR-CLIP	22012620
MIRT535630	hsa-miR-624-3p	PAR-CLIP	22012620
MIRT535629	hsa-miR-6884-3p	PAR-CLIP	22012620
MIRT535628	hsa-miR-3121-5p	PAR-CLIP	22012620
MIRT535627	hsa-miR-3912-5p	PAR-CLIP	22012620
MIRT535626	hsa-miR-514a-3p	PAR-CLIP	22012620
MIRT535625	hsa-miR-514b-3p	PAR-CLIP	22012620
MIRT535623	hsa-miR-4646-3p	PAR-CLIP	22012620
MIRT535624	hsa-miR-2355-3p	PAR-CLIP	22012620
MIRT608868	hsa-miR-1206	HITS-CLIP	27418678
MIRT608868	hsa-miR-1206	HITS-CLIP	27418678
MIRT608868	hsa-miR-1206	HITS-CLIP	27418678
MIRT608868	hsa-miR-1206	HITS-CLIP	27418678
MIRT608868	hsa-miR-1206	HITS-CLIP	27418678
MIRT608870	hsa-miR-124-5p	HITS-CLIP	27418678
MIRT608870	hsa-miR-124-5p	HITS-CLIP	27418678
MIRT608870	hsa-miR-124-5p	HITS-CLIP	27418678
MIRT608870	hsa-miR-124-5p	HITS-CLIP	27418678
MIRT608870	hsa-miR-124-5p	HITS-CLIP	27418678
MIRT608866	hsa-miR-1298-5p	HITS-CLIP	27418678
MIRT608866	hsa-miR-1298-5p	HITS-CLIP	27418678
MIRT608866	hsa-miR-1298-5p	HITS-CLIP	27418678
MIRT608866	hsa-miR-1298-5p	HITS-CLIP	27418678
MIRT608866	hsa-miR-1298-5p	HITS-CLIP	27418678
MIRT625927	hsa-miR-3922-5p	HITS-CLIP	27418678
MIRT608864	hsa-miR-4455	HITS-CLIP	27418678
MIRT608864	hsa-miR-4455	HITS-CLIP	27418678
MIRT608864	hsa-miR-4455	HITS-CLIP	27418678
MIRT608864	hsa-miR-4455	HITS-CLIP	27418678
MIRT608864	hsa-miR-4455	HITS-CLIP	27418678
MIRT625926	hsa-miR-561-5p	HITS-CLIP	27418678
MIRT625926	hsa-miR-561-5p	HITS-CLIP	27418678
MIRT608865	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT608865	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT608865	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT608865	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT608865	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT608867	hsa-miR-6853-3p	HITS-CLIP	27418678
MIRT608867	hsa-miR-6853-3p	HITS-CLIP	27418678
MIRT608867	hsa-miR-6853-3p	HITS-CLIP	27418678
MIRT608867	hsa-miR-6853-3p	HITS-CLIP	27418678
MIRT608867	hsa-miR-6853-3p	HITS-CLIP	27418678
MIRT608869	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT608869	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT608869	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT608869	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT608869	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT608869	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT608870	hsa-miR-124-5p	HITS-CLIP	23824327
MIRT608868	hsa-miR-1206	HITS-CLIP	23824327
MIRT608867	hsa-miR-6853-3p	HITS-CLIP	23824327
MIRT608866	hsa-miR-1298-5p	HITS-CLIP	23824327
MIRT608864	hsa-miR-4455	HITS-CLIP	23824327
MIRT608865	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT625927	hsa-miR-3922-5p	HITS-CLIP	23824327
MIRT608869	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT608870	hsa-miR-124-5p	HITS-CLIP	23824327
MIRT608868	hsa-miR-1206	HITS-CLIP	23824327
MIRT608867	hsa-miR-6853-3p	HITS-CLIP	23824327
MIRT625926	hsa-miR-561-5p	HITS-CLIP	23824327
MIRT608864	hsa-miR-4455	HITS-CLIP	23824327
MIRT608865	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT625927	hsa-miR-3922-5p	HITS-CLIP	23824327
MIRT608869	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT608870	hsa-miR-124-5p	HITS-CLIP	23824327
MIRT608868	hsa-miR-1206	HITS-CLIP	23824327
MIRT608867	hsa-miR-6853-3p	HITS-CLIP	23824327
MIRT625926	hsa-miR-561-5p	HITS-CLIP	23824327
MIRT608864	hsa-miR-4455	HITS-CLIP	23824327
MIRT608865	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT608869	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT608870	hsa-miR-124-5p	HITS-CLIP	23824327
MIRT608868	hsa-miR-1206	HITS-CLIP	23824327
MIRT608867	hsa-miR-6853-3p	HITS-CLIP	23824327
MIRT608866	hsa-miR-1298-5p	HITS-CLIP	23824327
MIRT608864	hsa-miR-4455	HITS-CLIP	23824327
MIRT608865	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT625927	hsa-miR-3922-5p	HITS-CLIP	23824327
MIRT608869	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT608870	hsa-miR-124-5p	HITS-CLIP	23824327
MIRT608868	hsa-miR-1206	HITS-CLIP	23824327
MIRT608867	hsa-miR-6853-3p	HITS-CLIP	23824327
MIRT625926	hsa-miR-561-5p	HITS-CLIP	23824327
MIRT608866	hsa-miR-1298-5p	HITS-CLIP	23824327
MIRT608864	hsa-miR-4455	HITS-CLIP	23824327
MIRT608865	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT608869	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT608870	hsa-miR-124-5p	HITS-CLIP	23824327
MIRT608868	hsa-miR-1206	HITS-CLIP	23824327
MIRT608867	hsa-miR-6853-3p	HITS-CLIP	23824327
MIRT608866	hsa-miR-1298-5p	HITS-CLIP	23824327
MIRT608864	hsa-miR-4455	HITS-CLIP	23824327
MIRT608865	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT535629	hsa-miR-6884-3p	PAR-CLIP	20371350
MIRT535628	hsa-miR-3121-5p	PAR-CLIP	20371350
MIRT535627	hsa-miR-3912-5p	PAR-CLIP	20371350
MIRT535626	hsa-miR-514a-3p	PAR-CLIP	20371350
MIRT535625	hsa-miR-514b-3p	PAR-CLIP	20371350
MIRT535623	hsa-miR-4646-3p	PAR-CLIP	20371350
MIRT535624	hsa-miR-2355-3p	PAR-CLIP	20371350
MIRT535635	hsa-miR-4662a-3p	PAR-CLIP	22012620
MIRT535634	hsa-miR-3925-5p	PAR-CLIP	22012620
MIRT535633	hsa-miR-3123	PAR-CLIP	22012620
MIRT535632	hsa-miR-3976	PAR-CLIP	22012620
MIRT535631	hsa-miR-6739-5p	PAR-CLIP	22012620
MIRT535630	hsa-miR-624-3p	PAR-CLIP	22012620
MIRT535629	hsa-miR-6884-3p	PAR-CLIP	22012620
MIRT535628	hsa-miR-3121-5p	PAR-CLIP	22012620
MIRT535627	hsa-miR-3912-5p	PAR-CLIP	22012620
MIRT535626	hsa-miR-514a-3p	PAR-CLIP	22012620
MIRT535625	hsa-miR-514b-3p	PAR-CLIP	22012620
MIRT535623	hsa-miR-4646-3p	PAR-CLIP	22012620
MIRT535624	hsa-miR-2355-3p	PAR-CLIP	22012620
MIRT1192474	hsa-miR-1298	CLIP-seq
MIRT1192475	hsa-miR-1827	CLIP-seq
MIRT1192476	hsa-miR-183	CLIP-seq
MIRT1192477	hsa-miR-4717-3p	CLIP-seq
MIRT1192478	hsa-miR-564	CLIP-seq
MIRT1192474	hsa-miR-1298	CLIP-seq
MIRT2055928	hsa-miR-3140-5p	CLIP-seq
MIRT2055929	hsa-miR-4793-5p	CLIP-seq
MIRT2055930	hsa-miR-4796-3p	CLIP-seq
MIRT2055931	hsa-miR-548t	CLIP-seq
MIRT2284636	hsa-miR-4672	CLIP-seq
MIRT2284637	hsa-miR-4789-5p	CLIP-seq

Show/Hide all (72)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001662	Process	Behavioral fear response	IEA
GO:0002052	Process	Positive regulation of neuroblast proliferation	IEA
GO:0002118	Process	Aggressive behavior	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003707	Function	Nuclear steroid receptor activity	TAS	9628820
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0005515	Function	Protein binding	IPI	28420882, 36321378
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007399	Process	Nervous system development	TAS	9628820
GO:0007405	Process	Neuroblast proliferation	IEA
GO:0007420	Process	Brain development	IEA
GO:0007601	Process	Visual perception	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0019899	Function	Enzyme binding	IEA
GO:0021542	Process	Dentate gyrus development	IEA
GO:0021764	Process	Amygdala development	IEA
GO:0021772	Process	Olfactory bulb development	IEA
GO:0021819	Process	Layer formation in cerebral cortex	IEA
GO:0021872	Process	Forebrain generation of neurons	IEA
GO:0021895	Process	Cerebral cortex neuron differentiation	IEA
GO:0021953	Process	Central nervous system neuron differentiation	IEA
GO:0021960	Process	Anterior commissure morphogenesis	IEA
GO:0021987	Process	Cerebral cortex development	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0030518	Process	Nuclear receptor-mediated steroid hormone signaling pathway	IEA
GO:0030522	Process	Intracellular receptor signaling pathway	IEA
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0035176	Process	Social behavior	IEA
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0043010	Process	Camera-type eye development	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043615	Process	Astrocyte cell migration	IEA
GO:0045165	Process	Cell fate commitment	IEA
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045787	Process	Positive regulation of cell cycle	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048708	Process	Astrocyte differentiation	IEA
GO:0048712	Process	Negative regulation of astrocyte differentiation	IEA
GO:0048814	Process	Regulation of dendrite morphogenesis	IEA
GO:0051128	Process	Regulation of cellular component organization	IEA
GO:0060041	Process	Retina development in camera-type eye	IEA
GO:0060164	Process	Regulation of timing of neuron differentiation	IEA
GO:0060291	Process	Long-term synaptic potentiation	IEA
GO:0061351	Process	Neural precursor cell proliferation	IEA
GO:0090049	Process	Regulation of cell migration involved in sprouting angiogenesis	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA
GO:2000178	Process	Negative regulation of neural precursor cell proliferation	IEA
GO:2000179	Process	Positive regulation of neural precursor cell proliferation	IEA
GO:2000648	Process	Positive regulation of stem cell proliferation	IEA

MIM	HGNC	e!Ensembl
603849	7973	ENSG00000112333

Q9Y466

Protein name

Nuclear receptor subfamily 2 group E member 1 (Nuclear receptor TLX) (Protein tailless homolog) (Tll) (hTll)

Protein function

Orphan receptor that binds DNA as a monomer to hormone response elements (HRE) containing an extended core motif half-site sequence 5'-AAGGTCA-3' in which the 5' flanking nucleotides participate in determining receptor specificity (By similarity

PDB

4XAJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00105	zf-C4	14 → 85	Zinc finger, C4 type (two domains)	Domain
PF00104	Hormone_recep	172 → 367	Ligand-binding domain of nuclear hormone receptor	Domain

Tissue specificity

TISSUE SPECIFICITY: Brain specific. Present in all brain sections tested, highest levels in the caudate nucleus and hippocampus, weakest levels in the thalamus. {ECO:0000269|PubMed:9628820}.

Sequence

MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGNQGGC
PVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFRGHKEENGAAAHF
PSAALPAPAFFTAVTQLEPHGLELAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEV
ATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDAN
TLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTH
SGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEE
VFFKKTIGNVPITRLLSDMYKSSDI

Sequence length

385

Interactions

View interactions

	Reactome
			Nuclear Receptor transcription pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MICROCEPHALY	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NR2E1-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (49)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Aniridia	Aniridia	BEFREE	23213277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	Pubtator	23213277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anterior segment mesenchymal dysgenesis	Anterior segment mesenchymal dysgenesis	Pubtator	23213277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	30679601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behavior Disorders	Behavior Disorders	BEFREE	16000615, 18205168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	18205168		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	18205168, 20497236		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	PSYGENET_DG	20497236		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	BEFREE	20360385, 20814749, 23028043, 25557355, 26554934, 28527574, 30441799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	24936658, 30441799	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30441799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32721119	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22143938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	27997540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	25813674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eye Abnormalities	Eye abnormalities	Pubtator	23213277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eye Diseases	Eye disease	Pubtator	23213277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	31590127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	19794520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	20360385, 26838672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26838672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	20814749, 27881004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	18205168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irido-corneal dysgenesis	Anterior segment dysgenesis	BEFREE	23213277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	12079282		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	22516263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	9628820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30441799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25557355, 29555975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20814749, 25557355, 29042395, 30441799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	18205168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	17054721		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Microphthalmos	Microphthalmos	BEFREE	23213277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	Pubtator	23213277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20228800, 20814749, 22366949, 23660940, 25356871, 25557355, 26838672		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	26554934, 26738856, 28527574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Neoplasms	Nervous System Neoplasms	BEFREE	26738856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25356871, 27890558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	30679601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31590127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	23660940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	20228800, 21878675, 27997540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25557355, 29555975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18205168, 26965827		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	18205168		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPERMATOGENIC FAILURE 16	Spermatogenic Failure	BEFREE	29298896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22143938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31590127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratozoospermia	Teratozoospermia	BEFREE	31582806		★★★★★ ★☆☆☆☆ Found in Text Mining only

NR2E1 (nuclear receptor subfamily 2 group E member 1)