TLR2 (toll like receptor 2)

Gene

• Entrez ID: 7097
• Gene name: Toll like receptor 2
• Gene symbol: TLR2
• Synonyms (NCBI Gene): CD282, TIL4
• Chromosome: 4
• Chromosome location: 4q31.3
• Summary: The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and func

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs5743708	G>A	Risk-factor	Missense variant, coding sequence variant
rs121917864	C>T	Risk-factor	Missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001127	hsa-miR-105-5p	Luciferase reporter assay	19509287
MIRT001127	hsa-miR-105-5p	qRT-PCR	19509287
MIRT001127	hsa-miR-105-5p	Western blot	19509287
MIRT000449	hsa-miR-146a-5p	qRT-PCR, flow, Luciferase reporter assay, Western blot	20375304
MIRT006646	hsa-miR-19a-3p	Luciferase reporter assay, qRT-PCR, Western blot	22105995
MIRT006647	hsa-miR-19b-3p	Luciferase reporter assay, qRT-PCR, Western blot	22105995
MIRT019178	hsa-miR-335-5p	Microarray	18185580
MIRT020445	hsa-miR-106b-5p	Microarray	17242205
MIRT000449	hsa-miR-146a-5p	qRT-PCR;Other	20375304
MIRT052900	hsa-miR-154-5p	Luciferase reporter assay, qRT-PCR, Western blot	24242044
MIRT052900	hsa-miR-154-5p	Luciferase reporter assay, qRT-PCR, Western blot	24242044
MIRT006646	hsa-miR-19a-3p	Luciferase reporter assay, qRT-PCR, Western blot	28078022
MIRT733213	hsa-let-7b-5p	Microarray, Western blotting	32669469
MIRT733214	hsa-miR-144-3p	Microarray, Western blotting	32669469
MIRT733215	hsa-miR-21-5p	Microarray, Western blotting	32669469
MIRT734448	hsa-miR-1236-3p	Immunoprecipitaion (IP), qRT-PCR, Western blotting	32913496
MIRT1426934	hsa-miR-143	CLIP-seq
MIRT1426935	hsa-miR-2110	CLIP-seq
MIRT1426936	hsa-miR-3150a-3p	CLIP-seq
MIRT1426937	hsa-miR-3175	CLIP-seq
MIRT1426938	hsa-miR-3685	CLIP-seq
MIRT1426939	hsa-miR-3691-5p	CLIP-seq
MIRT1426940	hsa-miR-384	CLIP-seq
MIRT1426941	hsa-miR-4260	CLIP-seq
MIRT1426942	hsa-miR-4307	CLIP-seq
MIRT1426943	hsa-miR-4318	CLIP-seq
MIRT1426944	hsa-miR-4676-5p	CLIP-seq
MIRT1426945	hsa-miR-4752	CLIP-seq
MIRT1426946	hsa-miR-4770	CLIP-seq
MIRT1426947	hsa-miR-518d-5p	CLIP-seq
MIRT1426948	hsa-miR-519b-5p	CLIP-seq
MIRT1426949	hsa-miR-519c-5p	CLIP-seq
MIRT1426950	hsa-miR-520c-5p	CLIP-seq
MIRT1426951	hsa-miR-526a	CLIP-seq
MIRT1426952	hsa-miR-548l	CLIP-seq
MIRT1426953	hsa-miR-548n	CLIP-seq
MIRT1426954	hsa-miR-567	CLIP-seq
MIRT1426955	hsa-miR-575	CLIP-seq
MIRT1426956	hsa-miR-939	CLIP-seq
MIRT2127862	hsa-miR-3919	CLIP-seq
MIRT2643042	hsa-miR-2113	CLIP-seq
MIRT2643043	hsa-miR-4294	CLIP-seq
MIRT2643044	hsa-miR-4474-3p	CLIP-seq
MIRT2643045	hsa-miR-4701-5p	CLIP-seq
MIRT2643046	hsa-miR-588	CLIP-seq
MIRT2643047	hsa-miR-663b	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HIF1A	Unknown	18159247
NFKB1	Activation	12686724;19779021
RELA	Activation	12686724;19779021
SP1	Activation	18423053
SP1	Unknown	18583567

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001530	Function	Lipopolysaccharide binding	IDA	11274165
GO:0001540	Function	Amyloid-beta binding	IDA	22198949
GO:0001540	Function	Amyloid-beta binding	ISS
GO:0001875	Function	Lipopolysaccharide immune receptor activity	TAS	11518816
GO:0002224	Process	Toll-like receptor signaling pathway	IBA
GO:0002224	Process	Toll-like receptor signaling pathway	IDA	16893894
GO:0002224	Process	Toll-like receptor signaling pathway	IEA
GO:0002224	Process	Toll-like receptor signaling pathway	ISS
GO:0002376	Process	Immune system process	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	11441107, 12594264, 15657077, 15728506, 16293622, 16622205, 16880211, 17095513, 17126326, 18765807, 19509286, 19880448, 20067962, 20802527, 23155421, 23376921, 24658140, 29990310, 31980649
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	19740627
GO:0005794	Component	Golgi apparatus	IDA	16880211
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	11274165, 19509287, 19740627
GO:0005886	Component	Plasma membrane	NAS	16893894, 33576548
GO:0005886	Component	Plasma membrane	TAS	9435236
GO:0006915	Process	Apoptotic process	TAS	10426996
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	10426995
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	10426995, 10426996, 11044375
GO:0007612	Process	Learning	ISS
GO:0009986	Component	Cell surface	IDA	12443841
GO:0010628	Process	Positive regulation of gene expression	IMP	23817958
GO:0014005	Process	Microglia development	ISS
GO:0016020	Component	Membrane	IEA
GO:0030177	Process	Positive regulation of Wnt signaling pathway	IMP	16601243
GO:0030667	Component	Secretory granule membrane	TAS
GO:0030670	Component	Phagocytic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IEA
GO:0032722	Process	Positive regulation of chemokine production	IDA	19740627
GO:0032728	Process	Positive regulation of interferon-beta production	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	ISS
GO:0032741	Process	Positive regulation of interleukin-18 production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	19740627
GO:0032755	Process	Positive regulation of interleukin-6 production	IGI	28078022
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	17128265
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	19740627
GO:0032757	Process	Positive regulation of interleukin-8 production	IGI	22198949
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0034134	Process	Toll-like receptor 2 signaling pathway	IDA	17128265
GO:0035325	Function	Toll-like receptor binding	IPI	16880211
GO:0035354	Component	Toll-like receptor 1-Toll-like receptor 2 protein complex	IDA	17889651
GO:0035354	Component	Toll-like receptor 1-Toll-like receptor 2 protein complex	IPI	17889651
GO:0035355	Component	Toll-like receptor 2-Toll-like receptor 6 protein complex	IDA	16880211, 19931471
GO:0035355	Component	Toll-like receptor 2-Toll-like receptor 6 protein complex	IPI	23155421
GO:0038023	Function	Signaling receptor activity	IBA
GO:0038023	Function	Signaling receptor activity	TAS	10426995
GO:0038124	Process	Toll-like receptor TLR6:TLR2 signaling pathway	IDA	23626692
GO:0038187	Function	Pattern recognition receptor activity	IDA	10384090
GO:0042495	Process	Detection of triacyl bacterial lipopeptide	IDA	19931471
GO:0042496	Process	Detection of diacyl bacterial lipopeptide	IDA	19931471
GO:0042497	Function	Triacyl lipopeptide binding	IBA
GO:0042497	Function	Triacyl lipopeptide binding	IDA	17889651
GO:0042802	Function	Identical protein binding	IPI	23155421
GO:0042834	Function	Peptidoglycan binding	IDA	11986301
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	19740627
GO:0043235	Component	Receptor complex	IBA
GO:0043235	Component	Receptor complex	IEA
GO:0043235	Component	Receptor complex	IPI	23155421
GO:0044877	Function	Protein-containing complex binding	IPI	22198949
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	NAS	11095740, 33576548
GO:0045087	Process	Innate immune response	TAS	15356140
GO:0045121	Component	Membrane raft	IDA	16880211
GO:0045121	Component	Membrane raft	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0050729	Process	Positive regulation of inflammatory response	IDA	19740627
GO:0050729	Process	Positive regulation of inflammatory response	IGI	28078022
GO:0050765	Process	Negative regulation of phagocytosis	ISS
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	11521063
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	12594207
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	21618349
GO:0051607	Process	Defense response to virus	IEP	32634389
GO:0051964	Process	Negative regulation of synapse assembly	ISS
GO:0061809	Function	NAD+ nucleosidase activity, cyclic ADP-ribose generating	IEA
GO:0071221	Process	Cellular response to bacterial lipopeptide	TAS	15356140
GO:0071223	Process	Cellular response to lipoteichoic acid	IDA	12594207
GO:0071223	Process	Cellular response to lipoteichoic acid	IMP	26649771
GO:0071346	Process	Cellular response to type II interferon	IDA	11672593
GO:0071726	Process	Cellular response to diacyl bacterial lipopeptide	IDA	19931471
GO:0071726	Process	Cellular response to diacyl bacterial lipopeptide	IDA	16880211
GO:0071727	Process	Cellular response to triacyl bacterial lipopeptide	IDA	19931471
GO:0071727	Process	Cellular response to triacyl bacterial lipopeptide	IDA	16880211
GO:1903974	Process	Positive regulation of cellular response to macrophage colony-stimulating factor stimulus	IDA	11672593
GO:1904466	Process	Positive regulation of matrix metallopeptidase secretion	IGI	28078022

Other IDs

• MIM: 603028
• HGNC: 11848
• e!Ensembl: ENSG00000137462

Protein

• UniProt ID: O60603
• Protein name: Toll-like receptor 2 (Toll/interleukin-1 receptor-like protein 4) (CD antigen CD282)
• Protein function: Cooperates with LY96 to mediate the innate immune response to bacterial lipoproteins and other microbial cell wall components. Cooperates with TLR1 or TLR6 to mediate the innate immune response to bacterial lipoproteins or lipopeptides (PubMed:1
• PDB: 1FYW, 1FYX, 1O77, 2Z7X, 2Z80, 6NIG, 8AR0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13855	LRR_8	76 → 135	Leucine rich repeat	Repeat
  PF01463	LRRCT	561 → 586	Leucine rich repeat C-terminal domain	Family
  PF01582	TIR	640 → 784	TIR domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in peripheral blood leukocytes, in particular in monocytes, in bone marrow, lymph node and in spleen. Also detected in lung and in fetal liver. Levels are low in other tissues.
• Sequence:

  MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLS
  NNRITYISNSDLQRCVNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWF
  KPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELE
  IDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVECLELRDTDLDTFHFS
  ELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDN
  DRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFLVPCLLSQHLK
  SLEYLDLSENLMVEEYLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNIDI
  SKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFSLNLPQLK
  ELYISRNKLMTLPDASLLPMLLVLKISRNAITTFSKEQLDSFHTLKTLEAGGNNFICSCE
  FLSFTQEQQALAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALFL
  LILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMV
  QELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFS
  HFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRA
  AIKS

• Sequence length: 784

Pathways

KEGG:

Phagosome
PI3K-Akt signaling pathway
Neutrophil extracellular trap formation
Toll-like receptor signaling pathway
Salmonella infection
Legionellosis
Leishmaniasis
Chagas disease
Malaria
Toxoplasmosis
Amoebiasis
Tuberculosis
Hepatitis B
Measles
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection
Coronavirus disease - COVID-19
Proteoglycans in cancer
PD-L1 expression and PD-1 checkpoint pathway in cancer
Inflammatory bowel disease
Rheumatoid arthritis
Lipid and atherosclerosis

Reactome:

ER-Phagosome pathway
Beta defensins
MyD88:MAL(TIRAP) cascade initiated on plasma membrane
Toll Like Receptor TLR1:TLR2 Cascade
Toll Like Receptor TLR6:TLR2 Cascade
MyD88 deficiency (TLR2/4)
IRAK4 deficiency (TLR2/4)
Regulation of TLR by endogenous ligand
Neutrophil degranulation
Modulation by Mtb of host immune system

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANTERIOR UVEITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC RHINITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BULLOUS PEMPHIGOID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Uncertain significance; Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFUSE SCLERODERMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary angioedema with normal C1Inh	not provided	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEPROSY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leprosy, susceptibility to, 3	risk factor; Benign; Likely benign; Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mycobacterium tuberculosis, susceptibility to	risk factor; Benign; Likely benign; Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELODYSPLASTIC SYNDROMES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEBORRHEIC DERMATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TLR2-related disorder	Likely benign; Conflicting classifications of pathogenicity; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TUBERCULOMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY TRACT INFECTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
AA amyloidosis	AA amyloidosis	BEFREE	17013994, 20714796		★☆☆☆☆ Found in Text Mining only
Acne	Acne	BEFREE	12133981, 18704103, 20861605, 23668840, 27902761, 28377308, 30737272, 31662521		★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	18704103, 20861605, 30737272, 31662521		★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	LHGDN	18704103		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	25179298, 31644579		★☆☆☆☆ Found in Text Mining only
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	28921377		★☆☆☆☆ Found in Text Mining only
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	29286200		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	25624047		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	18208411		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	19280717, 25872171		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	28279655		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	21960283, 27689189		★☆☆☆☆ Found in Text Mining only
Adenosine deaminase deficiency	Adenosine Deaminase Deficiency	BEFREE	25930993, 28095323		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	30756376		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	23946637, 26398587, 28739342, 30296412		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	26079505		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	19763595, 22402138, 31403268		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19849713, 21989233, 26738351, 35954209	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	33293506	Inhibit	★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	19849713		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	21163333, 21621299, 26553058		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	32096304	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	29520228, 30222725, 31509519		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	19091752, 30333729		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	19091752	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	31558702		★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	28667380, 30908604, 33013863	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	28667380		★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	15725697	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	15725697	Associate	★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	29935876		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	16277694		★☆☆☆☆ Found in Text Mining only
Anterior uveitis	Uveitis	LHGDN	17389503		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anterior uveitis	Uveitis	BEFREE	31465768		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety	Anxiety Disorder	BEFREE	27751870, 30033154		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	27751870, 30033154		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	32284335, 34814367	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	23412709		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	19195606, 20382708	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	20382708		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	Pubtator	24336024	Associate	★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial Occlusive Disease	BEFREE	15769459		★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	32022379	Stimulate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	15875151, 18029454, 20375592, 20505314, 21298446, 22229967, 23239459, 23369747, 24116867, 26657991, 27224005, 28257481, 28478461, 28814639, 29375683, 30351354, 30914314, 31187839		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	Pubtator	35840880	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	17599732, 18060042, 18975326, 22661088, 29330323, 30509503		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	17599732		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	18975326	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Infectious	Infective arthritis	Pubtator	20740673, 25412934	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	23121667, 31941549	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	21811995, 31781672	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Reactive	Reactive arthritis	Pubtator	18975326	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12651614, 15146415, 15593217, 16052591, 17255320, 18446062, 20615213, 21858161, 22661088, 23213270, 24286242, 24708416, 24936783, 26055925, 26759164, 28225071, 28677621, 31376255, 31396542, 33605409	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15986373, 17599732, 22809173, 33377396	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	15007351, 17877764, 19096003, 19667087, 19842845, 20375592, 20599261, 20815312, 21129050, 21134221, 21239529, 21389010, 21438704, 21570715, 21570717, 22402138, 24112285, 24445834, 25530138, 25722071, 27460807, 27955890, 28035483, 28094276, 28252235, 28514297, 28696809, 28858111, 29775222, 29863259, 31403268		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	15007351		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	19096003	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	19842845	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	20815312, 21570715, 21570717, 22994343, 23861935, 26191227, 27084682, 27495363, 28933920, 29486764, 30864351, 31304782, 31403268, 33602227, 35189144	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	29912993		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	29912993	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	15875151, 18029454, 20375592, 20505314, 21298446, 22229967, 23239459, 23369747, 24116867, 26657991, 27224005, 28257481, 28478461, 28814639, 29375683, 30351354, 30914314, 31187839		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	16270639, 17872459, 18974386		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	18029454, 21298446, 22357188, 22613713, 23573259, 24346141, 26657991, 34020127, 34122426, 35509837, 35840880	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	19167648	Stimulate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	29375116	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	22226452	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	35082275	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	29793131		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	21978687, 22024499, 23589304, 24352680, 26079624, 27067450, 28007303, 28011917, 29757592		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	24975964, 25531754, 26079624, 30618413	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Pancreatitis	Autoimmune pancreatitis	Pubtator	28921377	Stimulate	★☆☆☆☆ Found in Text Mining only
Autonomic nervous system disorders	Autonomic Central Nervous System Diseases	BEFREE	25628407		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	28836400		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	16899594, 24912772		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	28083607		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	27689189		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	27689189	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	16901312, 18336589, 18411217, 19014987, 19693643, 23211828, 23940075, 24255044		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet disease	Pubtator	18336589, 23940075	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet disease	Pubtator	32756992	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary Atresia	Biliary Atresia	BEFREE	21832949, 24651485		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	24882191, 25790282, 26795430		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	24882191		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	25790282	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23142523, 31448424		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	29869943	Associate	★☆☆☆☆ Found in Text Mining only
Body Weight	Body weight	Pubtator	27888296	Associate	★☆☆☆☆ Found in Text Mining only
Brachydactyly Type D	Brachydactyly	Pubtator	28504607	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	31509519		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	30808918		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	19143470, 30720218		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19810822, 20520770, 21079774, 21149644, 22560646, 26188904, 28490891		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20520770, 22560646, 26188904, 35102665, 38420813	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	17207025		★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	Pubtator	18684966	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	24112285, 24445834, 30924193		★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	29253610	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	23518821		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	23518821	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Digestive System	Gastric Cancer	BEFREE	24376595		★☆☆☆☆ Found in Text Mining only
Capillary malformation (disorder)	Capillary malformation	BEFREE	14768719		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21845432, 27689189, 30888638	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22309608, 24964964, 26722463, 27492456, 28009434, 31578587	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23142523, 31448424		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31212097		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	30246618, 31381571	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31950034, 36854280	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	25973005	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23424670, 29343281		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	15505089		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	BEFREE	28256509		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	Pubtator	30044791	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	15505089		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	17332447, 27004566, 31601156		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	22357188, 33172487, 34258923, 35840880, 36012132, 37400578	Associate	★☆☆☆☆ Found in Text Mining only
Carditis	Carditis	BEFREE	19461880		★☆☆☆☆ Found in Text Mining only
Carotid Artery Thrombosis	Carotid artery thrombosis	Pubtator	24578102	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Thrombosis	Carotid Artery Thrombosis	BEFREE	30261531		★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	16125159		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	27356567		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	32076951	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	18205922	Associate	★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	27725770		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	17667714, 23658628, 23844808, 30057921		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	23844808	Inhibit	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	30057921	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	31509519		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	23484049	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	21206505	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	25590839, 29039449, 29520167		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	27040385	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	21887520, 28584116, 29085577, 30355103		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	19541348, 26548749, 28009429		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	27828735, 28009429		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	19541348, 26548749, 28009429		★☆☆☆☆ Found in Text Mining only
Chediak-Higashi Syndrome	Chediak-Higashi Syndrome	BEFREE	25528552		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	16107886		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	15007351, 19148143, 20685742, 30924193		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	27616304	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	BEFREE	16035096		★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	LHGDN	16035096		★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	Pubtator	16035096	Associate	★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	31453712		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	CTD_human_DG	27989131		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholesteatoma	Cholesteatoma	BEFREE	23440434, 25922834		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	32915926	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	29138803	Inhibit	★☆☆☆☆ Found in Text Mining only
Chorioretinitis	Chorioretinitis	BEFREE	20140383		★☆☆☆☆ Found in Text Mining only
Chromosome 11p11.2 Deletion Syndrome	11p11.2 Deletion Syndrome	BEFREE	31465768		★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	28095323		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	26490558		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	16971956, 28083607, 29156691, 30196472		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	16004610, 16606450		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	19381722, 21239529, 21439805, 22952638, 23606791, 24528166, 26361369, 28536249, 29025711, 29078091, 29535517, 30268700, 30298576, 31548332		★☆☆☆☆ Found in Text Mining only
Chronic otitis media	Otitis media	BEFREE	26055429		★☆☆☆☆ Found in Text Mining only
Chronic Pain	Chronic pain	Pubtator	26668319	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	14738464, 15664906, 17555409, 17956467, 18618036, 20041977, 20232093, 21899586, 22251071, 23747679, 28910171		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	15664906, 16428799, 17176826	Inhibit	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	24363500, 30571680	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Q Fever	Q Fever	BEFREE	30800124		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	21493395		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	12610323, 22173151, 22330637, 24530748, 27183918, 27769109		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	28323396		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28336553		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	16790781, 16949315, 17653282, 20161736, 20885960, 23636052, 27563173, 28683149, 30782858, 31383741		★☆☆☆☆ Found in Text Mining only
Colitis Microscopic	Microscopic colitis	Pubtator	27672296	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	18040078, 24828022, 24971461	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	22185629, 24971461, 27895398, 35876170, 36768553, 37055495	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	31842582, 35733095	Inhibit	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21792899, 24390484, 30377568, 30532554, 30987352		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	39223499	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16879199, 20885960, 21625017, 22999059, 23866094, 26167073, 29566186, 29689497, 29883450, 30065713, 31132191		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	16879199, 17892325		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11725828, 21625017, 21792899, 21845432, 24390484, 25541970, 26072521, 26167073, 28765705, 29566186, 29883450, 30598580, 30987352, 36649244	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16879199		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	16879199, 17892325		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	20885960		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25547486, 32050430	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	20177958, 21548449, 29757592		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	27188997, 37626865	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	29757592	Stimulate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	17187404, 18565796, 20667457, 25814467, 26436722, 27769109, 28414577, 28715645		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	30551457		★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	21832949, 24651485		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29929978, 29959987, 30605239		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	29959987		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Aneurysm	Coronary aneurysm	Pubtator	32022379	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	24371373, 25542811, 29538462, 31644579		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	17172927		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	25542811, 26841679		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	31644579, 37824465	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	16297172, 29121163	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	25542811, 31452718		★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary Restenosis	LHGDN	15875151		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	BEFREE	31452718		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	21493395, 22182736		★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	20957032	Inhibit	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	15214053, 17914947, 21406388, 24776844, 24971461, 26023918, 28388655, 30517639		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	19094116, 19589946, 21157977, 24971461, 27895399, 30015893, 34799637	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	24828022	Stimulate	★☆☆☆☆ Found in Text Mining only
Cryoglobulinemia	Cryoglobulinemia	BEFREE	30930876		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	29588627		★☆☆☆☆ Found in Text Mining only
Cystic Disease Of Lung	Cystic lung disease	Pubtator	18684966	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	14656745, 15776129, 16478769, 18423053, 20083669, 23994582, 30626802		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	15321993, 15776129, 22466961, 30626802	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	18423053		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	18423053, 18684966	Stimulate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	16319097, 17182109, 18584044, 19035519, 21798884, 26982743, 30903825, 31734268		★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Deglutition disorder	Pubtator	32164729	Associate	★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	17653282, 26645352		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	31176103		★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	36056458	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	33112414	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	18704103, 24698321, 25456159		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	Pubtator	18704103	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	19849713, 22032785, 22686584, 22710427, 26682905, 28443596, 28593178, 32280674	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	15007364, 17531301, 18234309, 18445187		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	18234309, 18445187, 19392987, 19627277, 19849713, 21134221, 21261663, 21447101, 22032785, 22686584, 23223142, 24698321, 25912722, 26534745, 28443596, 28593178, 29672867, 30273064		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	BEFREE	12133981, 25707385		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	19953283	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	19455302, 28164040, 28336553, 28822965, 29059081		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	15699513		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	19455302, 25303153, 28164040, 28336553, 28822965, 29059081		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22357188, 36903646	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	18029454	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	19455302, 20153491, 20956025	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	20067962, 27904654	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	25959254	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28122717, 28445304, 36552771, 37876569	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	15699513, 17130564, 18029454, 19148143, 19455302, 29184392, 31677982		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	LHGDN	18029454		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20067962, 25541252, 26345801, 28445304, 28822965, 28933050, 30124003		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	24352680		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	28336553		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	30454704		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic Foot	BEFREE	28445304		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	28445304	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	22021706, 28352321, 28626209, 29059081		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	25610879, 27173229		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	25610879, 37773794	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	27150852	Stimulate	★☆☆☆☆ Found in Text Mining only
Diverticular Diseases	Diverticular disease	Pubtator	25133198	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	31611734		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	31611734	Associate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	22025895	Associate	★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	18809506		★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	25628407		★☆☆☆☆ Found in Text Mining only
Dysbiosis	Dysbiosis	Pubtator	39719586	Associate	★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	20610663	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	19661481, 31507457		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	18651887		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	18234309, 18445187, 19392987, 19627277, 19849713, 20646366, 21134221, 21261663, 21447101, 22032785, 22686584, 23223142, 24698321, 25912722, 26534745, 28443596, 28593178, 29672867, 30273064		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	29760708		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	38420813	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31675995		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	20646321	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	23935397, 31636643		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	23935397	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	32236327, 32751735	Associate	★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	BEFREE	28281719, 31682933		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	19667087		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilia	Eosinophilia	CTD_human_DG	26882889		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilia, Tropical	Eosinophilia	CTD_human_DG	26882889		★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	29691386	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	31026566		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	29968427	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	29968427	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	33686512	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	21960283		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	28560381, 31805646		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cylindromatosis	Familial cylindromatosis	Pubtator	16230348	Inhibit	★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	23657238		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP C	Fanconi Anemia	BEFREE	26999096		★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	31388096	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	25534427, 27834919, 29482933, 31388096		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29366780, 30708193		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	30125459		★☆☆☆☆ Found in Text Mining only
Fulminant hepatitis	Fulminant Hepatitis	BEFREE	27273587		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	20492496, 21283657		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	21283657	Associate	★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	16328011, 17934843		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	16328011, 17934843		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	28368946	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	21128061		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	27689189, 33686512	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	39719586	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	28844484		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	29085211	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	37600779	Inhibit	★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingival diseases	Pubtator	17176826	Stimulate	★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	18454672		★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	LHGDN	18454672		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	26866668		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21705839, 32999164	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30720218		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19143470, 30720218		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24752463, 25452390, 30131377, 30898699		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34643804	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	27818460	Stimulate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	34861820	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	22762240	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	22703024		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	31554206		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	31554206	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	33407998	Associate	★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	25954926		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	18336589, 28736999		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	30924423, 31199456		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	36982416	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	22662111	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	29957254		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	30044791, 39719586	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29929978, 29959987, 30605239		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	CTD_human_DG	29959987		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	29959987		★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	24612145		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	28484092		★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	19597734		★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	25337250	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	22491449, 27183918	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	22491449	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary pyropoikilocytosis	Hereditary pyropoikilocytosis	BEFREE	21154739		★☆☆☆☆ Found in Text Mining only
HETEROTAXY, VISCERAL, 2, AUTOSOMAL	Heterotaxy, Visceral	BEFREE	27723526		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	27818343		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	19447045, 25610879, 26908090		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	19447045	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	25610879	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	23230212, 31110312		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	26497845, 28775078, 31507457		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	25973005	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	22229967, 30864351, 32284335, 37400578	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	22229967, 23477738, 25657311, 25969543, 28693567, 31805646		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24927122	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26657991	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	21905008		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	22344343		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	24613046	Stimulate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	24756968		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	22025895, 22809173, 24927122, 27895398, 30908604	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	29976865		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	28166799		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	18509040, 28336553, 28684969, 31176103		★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	28243080		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	32751735	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	BEFREE	31487910		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	17595233, 17991289, 21203467, 22101184, 23239925, 24971461, 26023918, 27460807, 27670944, 28388655, 30200338		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	17595233, 18040078, 19589946, 23239925, 24828022, 24971461, 32478906, 36768553	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	17991289	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	18704103		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	20067962, 23213270	Stimulate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	22357188, 24043885, 31162913	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	23968377, 24997157	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	29323102		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	33863359	Stimulate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	18336589	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Volvulus	Intestinal Volvulus	BEFREE	19168746		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	29066233		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	27616304		★☆☆☆☆ Found in Text Mining only
Intrinsic Factor Deficiency	Intrinsic Factor Deficiency	BEFREE	26963509, 31845221		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	26999096		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	26999096	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	23028414, 28246611		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	23028414	Stimulate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	27150852, 37404119	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	21887520, 30377701		★☆☆☆☆ Found in Text Mining only
Jaundice, Obstructive	Jaundice	BEFREE	29366780		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	20571165, 25920454		★☆☆☆☆ Found in Text Mining only
Juvenile polyposis syndrome	Polyposis Syndrome	BEFREE	20937339, 29251000		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	16926427, 18398706, 19168746, 27528076, 30853520		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratitis	Keratitis	CTD_human_DG	23661603		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratoconjunctivitis Sicca	Keratoconjunctivitis Sicca	BEFREE	30230940		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	29021606		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	29021606	Stimulate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	36293206	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	21220755, 29923769	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	22021706, 28336553, 29777767		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	24480070, 28822965, 29500224, 30387162, 31534532, 31798708		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	29286200		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	LHGDN	17390084		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	26490558		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	21478107	Associate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	26588247		★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	29959987		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	12445799, 14501431, 15726416, 18177245, 22348338, 23619473, 28327786, 31781675		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leprosy	Leprosy	Pubtator	12595460, 18177245, 28327786, 29915584, 31781675, 33040382	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leprosy	Leprosy	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leprosy Lepromatous	Leprosy	Pubtator	11476982, 32824985	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	20307689, 30596396		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	25867213, 30196472	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	20814675, 25412934, 26963509, 33247673	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	18208411, 25412934, 25427560, 25624047, 26963509, 29296851, 31845221		★☆☆☆☆ Found in Text Mining only
Leukoencephalopathy	Leukoencephalopathy	BEFREE	28912641		★☆☆☆☆ Found in Text Mining only
Leukomalacia, Periventricular	Periventricular Leukomalacia	BEFREE	23419040		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	29296907		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	25099483	Stimulate	★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	28624699		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17696935, 21500195, 22309608, 22330637, 22617154, 22815694, 24530748, 27183918, 27492456, 27769109, 28009434, 28061318, 30526680, 30930876, 31578587, 31615295		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	12610323, 19811087, 21356257, 22173151, 22330637, 24530748, 27183918, 27769109		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Alcoholic	Liver cirrhosis	Pubtator	24260493	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	24260493		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	20153491, 27183918	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	16035096, 31578587	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	27284092	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	28329297		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	22617154		★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	20057905		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	16829623, 18602432, 23668840, 23994582		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	16829623, 17567674, 19835594, 36255321	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	LHGDN	17567674, 18602432		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases Interstitial	Lung disease	Pubtator	24613046	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	32233518	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	25466615, 26068236		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	18373699, 19843090, 24578102, 31396542, 33584646, 35864995	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	26079624	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	25466615, 26068236		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	14651524, 24578102, 25466615, 26068236, 26079624, 26386242, 27231253		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	26799193, 31667864		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	40011954	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	25466615, 26068236		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	24771328	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	16971956		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	24912772		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	19029192, 24912772, 27183918, 30930876		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	24912772		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	27183918	Associate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	23946637	Stimulate	★☆☆☆☆ Found in Text Mining only
Macular degeneration	Macular Degeneration	BEFREE	28739342		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19810822, 20520770, 21079774, 21149644, 22560646, 25362351, 26188904, 26392082, 28490891		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	20492496, 21283657		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31212097		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	28624699		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23424670, 29343281		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23098072		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22311043		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17711514, 21994405, 22468087, 23565226, 24929142, 26880585, 28481875, 30301709, 30364936, 30554285, 31173934		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23142523, 31448424		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16339564, 19082487, 19609015, 20520770, 21500195, 21845432, 22468087, 22560646, 23098072, 23581420, 23992203, 24289592, 24376595, 24390484, 25318697, 26372276, 30536754, 30541631, 30623441, 30898699, 30987352, 31418565, 31710083		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	19541348, 26548749, 28009429		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21792899, 24390484, 30377568, 30532554, 30987352		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	27637169		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	25790282		★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	19029192		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	29909409		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	26785369	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	19001446		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19001446, 25175033, 25765738, 34032721	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30150374		★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	28700093		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	25862837		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	22357188, 22991262	Stimulate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	22991262, 25329057, 25534427, 25978344		★☆☆☆☆ Found in Text Mining only
Microangiopathy, Diabetic	Diabetic cardiomyopathy	BEFREE	25303153		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	27091721	Stimulate	★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	20132814		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	25204704, 30121951	Associate	★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement disorder	Pubtator	33112414	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	22737215		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	25780885, 28061462, 34193364, 37824465, 37837870	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	20629663, 23593278, 24794258	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	19664140, 24975964, 29168181, 33112414, 33766068	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	23975865, 28555437, 29168181, 29593720, 30043528, 30740110, 30897575, 31351476, 31522431, 31734400		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	30740110	Stimulate	★☆☆☆☆ Found in Text Mining only
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	37830588	Associate	★☆☆☆☆ Found in Text Mining only
MUTYH-Associate Polyposis	Polyposis	BEFREE	19470169		★☆☆☆☆ Found in Text Mining only
MYD88 Deficiency	MYD88 Deficiency	BEFREE	21060793		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	20132814, 23765228, 28963909		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	CTD_human_DG	28963909		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	23765228, 34130612	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	35367529	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	27767332		★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	15505089		★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	29959987		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	18282141, 22229967, 29375116, 29381915, 29869943, 32594092, 33847684, 34799616, 39809140	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	18442320, 18832728, 29375116, 29929978		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	35840880	Stimulate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	24371373, 29538462		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	32164729	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	33172487, 34830017, 37876569	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	20109309, 25198021		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	25973005, 29768034, 33238997	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	22320262		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	22320262, 31238894	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	26785369, 29923769	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	23419040, 29648878		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	23419040, 29648878		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17711514, 20885960, 21625017, 22115967, 22468087, 22815694, 22906921, 23142523, 23424670, 23866094, 23970797, 24145436, 24242044, 25362351, 25862837, 25934696, 26167073, 26188904, 26646564, 26888865, 26988751, 27492456, 27708223, 27941378, 28346430, 28481875, 29212908, 29296526, 29467931, 29968427, 30541631, 30898699, 31118418, 31132191, 31183403, 31659256		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	30720218		★☆☆☆☆ Found in Text Mining only
Nephrosis congenital	Nephrotic syndrome	Pubtator	27355219	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29136637		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17997855		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	24975964	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30076830, 30333729, 31098954, 31766220		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	28495144, 31229737		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	31145897		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	29296907		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	18952897, 19667087		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	26212089, 26945479, 27834919, 27895422		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27831503, 28401532		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	25534427		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19403722, 25840582, 26498675, 28933050, 29428931		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	27481183, 31936430, 34632798, 35896710	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	32954825	Associate	★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	31272370	Associate	★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Obesity	Pubtator	27507606, 31388096	Associate	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	27507606		★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	30246618	Associate	★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic neuritis	Pubtator	36969199	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	15961329, 26982743, 31068249, 32616761	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	26982743	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	36216277	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	27614315, 28418842		★☆☆☆☆ Found in Text Mining only
Osteogenesis imperfecta type 3	Osteogenesis imperfecta	Pubtator	34426754	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	16487238, 25503704, 29218100, 29253124, 30711175		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	19306954, 23264656, 26409254, 28872184, 29995146, 31379855		★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	19586996, 21076367, 21818352, 26296608		★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	BEFREE	21076367		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	23424670, 29343281		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22528050, 23424670, 38010845	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25376541, 34439871	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23098072		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20510208, 27941651, 30246618	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	39221252	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Acute Necrotizing	Necrotizing pancreatitis	BEFREE	16489656		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23166414		★☆☆☆☆ Found in Text Mining only
Paracoccidioidomycosis	Paracoccidioidomycosis	Pubtator	25204704	Associate	★☆☆☆☆ Found in Text Mining only
Paratuberculosis	Paratuberculosis	BEFREE	17652449		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	20813038, 25099483, 35802825, 40280259	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	22552867, 25653107, 27888296, 28729076, 29077524, 30092810, 30333729		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	27888296	Stimulate	★☆☆☆☆ Found in Text Mining only
Peeling Skin Syndrome	Peeling skin syndrome	Pubtator	25048443	Stimulate	★☆☆☆☆ Found in Text Mining only
PEELING SKIN SYNDROME	Peeling Skin Syndrome	BEFREE	31465768		★☆☆☆☆ Found in Text Mining only
Pelvic Inflammatory Disease	Pelvic inflammatory disease	Pubtator	29286178	Associate	★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	27689189		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	BEFREE	28844484, 29755012		★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic ulcer disease	Pubtator	28844484, 29755012	Associate	★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	29995146		★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical periodontitis	Pubtator	35300329	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	14738464	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	26386242, 27224005, 28630066		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	14738464, 23981212	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	17956467, 18454672, 18618036, 20041977, 20337891, 21899586, 22251071, 23653009, 23747679, 23981212, 26409254, 26819203, 27107801, 27308827, 27739344, 28872184, 28910171, 28993635, 30351354, 31265058, 31769563		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	LHGDN	18454672, 18618036		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	36040155	Stimulate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	24472415		★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	27432741, 30538643		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	28249177, 30514502		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	26498675		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	34279173, 34632798	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	31675371		★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	25047402, 26818901		★☆☆☆☆ Found in Text Mining only
Polymyalgia Rheumatica	Polymyalgia rheumatica	Pubtator	37600779	Inhibit	★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	19953283	Associate	★☆☆☆☆ Found in Text Mining only
Porphyria Variegate	Variegate porphyria	Pubtator	33255933	Stimulate	★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	31176103		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	15856047, 20940109		★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	28341816	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22311043		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23657238, 36321189	Associate	★☆☆☆☆ Found in Text Mining only
prostatitis	Prostatitis	BEFREE	30618413		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	27818460	Associate	★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	17032411, 23489702		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	17229603, 17951129, 22555189, 23457721, 25561051, 25707385, 27155792, 31125591		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	34122426	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	27155792		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	21905008, 22229967	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Cystic Fibrosis	Pulmonary Cystic Fibrosis	BEFREE	18684966		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	11867630, 21439805, 22952638, 23606791, 29535517, 30677037, 31548332, 34426754, 35189144, 37083575	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	16004610, 37585174	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	16606450, 21483784, 23374856, 33590951	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	24205107		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	22344343, 28725012		★☆☆☆☆ Found in Text Mining only
Radiation Syndrome	Radiation Syndrome	BEFREE	22479357		★☆☆☆☆ Found in Text Mining only
Reactive systemic amyloidosis	Reactive Systemic Amyloidosis	BEFREE	17013994, 20714796		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	21792899		★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	BEFREE	25482673		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	30511622		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	28667380, 29486764	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	40495488	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	17096074, 19693643, 25487598, 26022377		★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic heart disease	Pubtator	26022377	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12651614, 14651524, 16319097, 16712654, 17182109, 17289161, 17599732, 18060042, 18315430, 18446062, 18584044, 19342676, 19378024, 20473500, 20615213, 22523426, 22661088, 23325096, 23420357, 24286242, 24708416, 24936783, 27108590, 27988432, 28225071, 29096690, 31620132		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	12651614, 14707104		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	19192274		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis	Rhinitis	BEFREE	18219831		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis Allergic	Rhinitis	Pubtator	16146574, 31403268	Associate	★☆☆☆☆ Found in Text Mining only
Rosacea	Rosacea	Pubtator	18704103	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	17565608, 21437199, 22150367, 23666053, 23668840		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	LHGDN	17565608		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	17565608, 21437199	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	23644137		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	23644137, 25687169		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schwartz-Jampel Syndrome	Schwartz-Jampel Syndrome	BEFREE	18813073		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	21905008, 33168071	Associate	★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	28202935	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	20835611, 22186927, 22881229, 33247673, 35345353	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	25412934	Stimulate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	12970043, 15086396, 15489631, 15753758, 16237639, 17622883, 18249133, 18424736, 19181857, 19828841, 20451670, 20463618, 20578945, 20835611, 21358639, 22186927, 23419040, 24366499, 24878008, 25412934, 26616674, 28391364, 28407632, 29760192, 30509503, 30850654, 31152389, 31412243, 31843260		★☆☆☆☆ Found in Text Mining only
Severe combined immunodeficiency due to adenosine deaminase deficiency	Severe combined immunodeficiency disease	BEFREE	25930993, 28095323		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	12595460	Associate	★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	20472585		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	17229603		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	32069296	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	32076951	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	23239459, 25604476, 26657991		★☆☆☆☆ Found in Text Mining only
Sleep-Disordered Breathing	Sleep Apnea	BEFREE	25604476		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	36931608	Associate	★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	18073264		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	16277694, 31781672	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	29269299		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19740321, 21179035, 33466212, 34158059	Associate	★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	19556696, 25179298		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29482933		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17711514, 21994405, 22468087, 23565226, 24929142, 25843196, 26880585, 28481875, 30301709, 30364936, 30554285, 31173934		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	21455638, 32719215	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17711514		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17711514, 22468087, 24927122, 25843196, 30301709, 30536754, 33525650, 34773930, 36632455	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34620075	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomatitis Aphthous	Aphthous stomatitis	Pubtator	39343890	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	21206505	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28634441		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	17289161		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	33377396	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	21905008, 24476318, 31465768		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	34002664	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	32425934	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	19572074, 24578102	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	23166414, 36120433	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	BEFREE	28363255		★☆☆☆☆ Found in Text Mining only
Tonsillitis	Tonsillitis	Pubtator	21159925	Associate	★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	18813073		★☆☆☆☆ Found in Text Mining only
Toxic Shock Syndrome	Toxic Shock Syndrome	BEFREE	23724118		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	16770571, 17565650, 19303021, 19528242, 23636052, 24776844, 24971461, 26023918, 28388655, 30058712, 30517639, 31383741		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	17565650		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33924332	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Tract Infections	Urinary tract infection	Pubtator	23484049, 27252945	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	28843340		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	26988751	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	26548749	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	26195555, 26238371		★☆☆☆☆ Found in Text Mining only
Uveitis Anterior	Anterior uveitis	Pubtator	22128242	Associate	★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	26238371		★☆☆☆☆ Found in Text Mining only
Vaginal Neoplasms	Vaginal neoplasms	Pubtator	29286178	Associate	★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	30474123		★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	21325271	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	24294367, 30626205		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	32954825	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	23065292, 29923769		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	24773611, 29923769	Associate	★☆☆☆☆ Found in Text Mining only
Vesicoureteral Reflux 1	Vesicoureteral Reflux	BEFREE	23484049		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	23875738	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	27124026		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	22429552		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	22429552		★☆☆☆☆ Found in Text Mining only
X-linked agammaglobulinemia	Agammaglobulinemia, X-Linked	BEFREE	28095323		★☆☆☆☆ Found in Text Mining only