TLE1 (TLE family member 1, transcriptional corepressor)

Gene

• Entrez ID: 7088
• Gene name: TLE family member 1, transcriptional corepressor
• Gene symbol: TLE1
• Synonyms (NCBI Gene): ESG, ESG1, GRG1, TLE-1
• Chromosome: 9
• Chromosome location: 9q21.32

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT007104	hsa-miR-657	Luciferase reporter assay, Western blot	23175432
MIRT007104	hsa-miR-657	Luciferase reporter assay, Western blot	23175432
MIRT021488	hsa-miR-191-5p	Sequencing	20371350
MIRT042606	hsa-miR-423-3p	CLASH	23622248
MIRT039611	hsa-miR-615-3p	CLASH	23622248
MIRT1426228	hsa-miR-125a-3p	CLIP-seq
MIRT1426229	hsa-miR-1270	CLIP-seq
MIRT1426230	hsa-miR-1283	CLIP-seq
MIRT1426231	hsa-miR-1294	CLIP-seq
MIRT1426232	hsa-miR-184	CLIP-seq
MIRT1426233	hsa-miR-2276	CLIP-seq
MIRT1426234	hsa-miR-3136-3p	CLIP-seq
MIRT1426235	hsa-miR-3164	CLIP-seq
MIRT1426236	hsa-miR-328	CLIP-seq
MIRT1426237	hsa-miR-3545-3p	CLIP-seq
MIRT1426238	hsa-miR-3609	CLIP-seq
MIRT1426239	hsa-miR-3668	CLIP-seq
MIRT1426240	hsa-miR-4272	CLIP-seq
MIRT1426241	hsa-miR-4531	CLIP-seq
MIRT1426242	hsa-miR-4708-3p	CLIP-seq
MIRT1426243	hsa-miR-494	CLIP-seq
MIRT1426244	hsa-miR-520d-5p	CLIP-seq
MIRT1426245	hsa-miR-524-5p	CLIP-seq
MIRT1426246	hsa-miR-544	CLIP-seq
MIRT1426247	hsa-miR-548ah	CLIP-seq
MIRT1426248	hsa-miR-552	CLIP-seq
MIRT1426249	hsa-miR-620	CLIP-seq
MIRT2127694	hsa-miR-1244	CLIP-seq
MIRT2127695	hsa-miR-3134	CLIP-seq
MIRT2127696	hsa-miR-3655	CLIP-seq
MIRT2127697	hsa-miR-4534	CLIP-seq
MIRT1426246	hsa-miR-544	CLIP-seq
MIRT2642789	hsa-miR-1273d	CLIP-seq
MIRT2642790	hsa-miR-1468	CLIP-seq
MIRT2642791	hsa-miR-1587	CLIP-seq
MIRT2642792	hsa-miR-186	CLIP-seq
MIRT2642793	hsa-miR-1912	CLIP-seq
MIRT2642794	hsa-miR-2355-5p	CLIP-seq
MIRT2642795	hsa-miR-3607-5p	CLIP-seq
MIRT2642796	hsa-miR-3614-5p	CLIP-seq
MIRT2642797	hsa-miR-4326	CLIP-seq
MIRT2642798	hsa-miR-4492	CLIP-seq
MIRT2642799	hsa-miR-4498	CLIP-seq
MIRT2642800	hsa-miR-4656	CLIP-seq
MIRT2642801	hsa-miR-4675	CLIP-seq
MIRT1426242	hsa-miR-4708-3p	CLIP-seq
MIRT2642802	hsa-miR-4741	CLIP-seq
MIRT2642803	hsa-miR-4749-3p	CLIP-seq
MIRT2642804	hsa-miR-4785	CLIP-seq
MIRT2642805	hsa-miR-635	CLIP-seq
MIRT2642806	hsa-miR-762	CLIP-seq
MIRT2642791	hsa-miR-1587	CLIP-seq
MIRT2642792	hsa-miR-186	CLIP-seq
MIRT2642793	hsa-miR-1912	CLIP-seq
MIRT2642794	hsa-miR-2355-5p	CLIP-seq
MIRT2642795	hsa-miR-3607-5p	CLIP-seq
MIRT2642796	hsa-miR-3614-5p	CLIP-seq
MIRT2642798	hsa-miR-4492	CLIP-seq
MIRT2642799	hsa-miR-4498	CLIP-seq
MIRT2642800	hsa-miR-4656	CLIP-seq
MIRT2642801	hsa-miR-4675	CLIP-seq
MIRT1426242	hsa-miR-4708-3p	CLIP-seq
MIRT2642802	hsa-miR-4741	CLIP-seq
MIRT2642805	hsa-miR-635	CLIP-seq
MIRT2642806	hsa-miR-762	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HHEX	Unknown	15187083

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0003714	Function	Transcription corepressor activity	IDA	10748198
GO:0005515	Function	Protein binding	IPI	9751710, 10748198, 12441302, 16169070, 17680780, 20211142, 21699783, 21900206, 22439931, 24356439, 24596249, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	10748198
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IMP	22952044
GO:0005634	Component	Nucleus	TAS	1303260
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005829	Component	Cytosol	IMP	22952044
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0007165	Process	Signal transduction	TAS	8808280
GO:0009887	Process	Animal organ morphogenesis	TAS	8808280
GO:0010628	Process	Positive regulation of gene expression	IMP	15006356
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IDA	9751710
GO:0042802	Function	Identical protein binding	IPI	24596249
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	17680780
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	9751710
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IBA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	8687460
GO:1990907	Component	Beta-catenin-TCF complex	IDA	28296634
GO:2000811	Process	Negative regulation of anoikis	IMP	15006356, 22952044

Other IDs

• MIM: 600189
• HGNC: 11837
• e!Ensembl: ENSG00000196781

Protein

• UniProt ID: Q04724
• Protein name: Transducin-like enhancer protein 1 (E(Sp1) homolog) (Enhancer of split groucho-like protein 1) (ESG1)
• Protein function: Transcriptional corepressor that binds to a number of transcription factors. Inhibits NF-kappa-B-regulated gene expression. Inhibits the transcriptional activation mediated by FOXA2, and by CTNNB1 and TCF family members in Wnt signaling. Enhance
• PDB: 1GXR, 2CE8, 2CE9, 4OM2, 4OM3, 5MWJ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03920	TLE_N	1 → 133	Groucho/TLE N-terminal Q-rich domain	Family
  PF00400	WD40	568 → 602	WD domain, G-beta repeat	Repeat
  PF00400	WD40	606 → 644	WD domain, G-beta repeat	Repeat

• Tissue specificity: TISSUE SPECIFICITY: In all tissues examined, mostly in brain, liver and muscle.
• Sequence:

  MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRH
  YVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELN
  AIIGQQQLQAQHLSHGHGPPVPLTPHPSGLQPPGIPPLGGSAGLLALSSALSGQSHLAIK
  DDKKHHDAEHHRDREPGTSNSLLVPDSLRGTDKRRNGPEFSNDIKKRKVDDKDSSHYDSD
  GDKSDDNLVVDVSNEDPSSPRASPAHSPRENGIDKNRLLKKDASSSPASTASSASSTSLK
  SKEMSLHEKASTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAIDPLVNQAAAGLRT
  PLAVPGPYPAPFGMVPHAGMNGELTSPGAAYASLHNMSPQMSAAAAAAAVVAYGRSPMVG
  FDPPPHMRVPTIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINT
  LNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLP
  DGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAV
  WDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQI
  FSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDN
  LLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY

• Sequence length: 770

Pathways

KEGG:

Wnt signaling pathway
Notch signaling pathway

Reactome:

Formation of the beta-catenin:TCF transactivating complex
Deactivation of the beta-catenin transactivating complex
Repression of WNT target genes

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNE SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOVEMENT DISORDER	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOVEMENT DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOOTH DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	30286331		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	18258796		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16452182, 26086099		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	27753659		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	BEFREE	30053869		★☆☆☆☆ Found in Text Mining only
Adenoma, Basal Cell	Adenoma	BEFREE	30053869		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30286331		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	18519670		★☆☆☆☆ Found in Text Mining only
Adult Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	17255769, 23929265		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	28599074	Associate	★☆☆☆☆ Found in Text Mining only
Atypical Teratoid Rhabdoid Tumor	Teratoid Rhabdoid Tumor	BEFREE	29490565		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	24650168	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	23287123		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	17553960	Inhibit	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	29316219	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22952044		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21536917, 22952044	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16452182, 27753659, 30608261		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12079511	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16452182, 25003198		★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	30608261		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	30286331		★☆☆☆☆ Found in Text Mining only
Childhood Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	17255769, 23929265		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26229111		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	21699783		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	17387319		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	17387319		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis	Dermatitis	BEFREE	31502279		★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma	Dermatofibrosarcoma	BEFREE	31614009		★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma Protuberans	Dermatofibrosarcoma Protuberans	BEFREE	31614009		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28744818		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	23457408, 25951451		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	31304751		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	18519670		★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	28382094		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	28382094		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	33794814	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	28800015		★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	31614009		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29316219		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	29316219	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29316219		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	18519670, 30286331		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	LHGDN	18519670		★☆☆☆☆ Found in Text Mining only
Histiocytoma, Angiomatoid Fibrous	Histiocytoma	BEFREE	28248724		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	33353041	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	18519670		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	18258796, 18519670		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	12079511	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25446087, 27655370, 37965333	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	29069783		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	12926049, 18519670		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22952044, 28382094		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16452182, 25003198, 26086099		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	27852056		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31050210		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16452182, 19809272, 22952044, 27852056, 30565298		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	17255769, 23287123, 23929265		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	22952044		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30608261		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	17387319		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	17387319		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma	Mesothelioma	BEFREE	30170702		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	29758293		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16452182, 23197007, 23287123, 26250366, 27753659, 29069783, 29742555, 30286331, 30608261, 31614009, 31702654		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	23287123		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22982182		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	23287123		★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	23287123		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	19363472	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	27557513	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	27852056		★☆☆☆☆ Found in Text Mining only
Peripheral Nerve Sheath Neoplasm	Peripheral Nerve Sheath Neoplasm	BEFREE	23197007		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	30286331		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	31502279		★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	29490565		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	17255769, 19809272, 23197007, 28197724		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	23287123	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	21319215, 23287123, 23929265, 24436244, 26434872, 27120803, 27401493, 27568668	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	27753659		★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	19809272, 20189377, 24422953		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30608261		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33000257	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31050210		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31050210	Associate	★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	17255769, 19809272, 20189377, 21319215, 23197007, 23287123, 23929265, 24289970, 24422953, 24436244, 25912315, 27753659, 28632567, 28800015, 29490565, 29742555, 30608261, 31614009		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	LHGDN	17255769		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28382094		★☆☆☆☆ Found in Text Mining only