Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7077
Gene name	TIMP metallopeptidase inhibitor 2
Gene symbol	TIMP2
Synonyms (NCBI Gene)	CSC-21KDDC8
Chromosome	17
Chromosome location	17q25.3
Summary	This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role a

938

Show/Hide all (938)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006198	hsa-miR-519d-3p	Luciferase reporter assayWestern blot	22262409
MIRT006198	hsa-miR-519d-3p	Luciferase reporter assayWestern blot	22262409
MIRT006198	hsa-miR-519d-3p	Luciferase reporter assayWestern blot	22262409
MIRT006639	hsa-miR-519c-3p	Luciferase reporter assayqRT-PCRWestern blot	22262409
MIRT006769	hsa-miR-200c-3p	Luciferase reporter assay	22685266
MIRT053595	hsa-miR-106a-5p	In situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	24440352
MIRT053595	hsa-miR-106a-5p	In situ hybridizationLuciferase reporter assayqRT-PCRWestern blot	24440352
MIRT053595	hsa-miR-106a-5p	Luciferase reporter assayqRT-PCRWestern blot	24444603
MIRT438104	hsa-miR-429	Luciferase reporter assayWestern blot	24866238
MIRT438104	hsa-miR-429	Luciferase reporter assayWestern blot	24866238
MIRT438104	hsa-miR-429	Luciferase reporter assayWestern blot	24866238
MIRT438104	hsa-miR-429	Luciferase reporter assayWestern blot	24866238
MIRT053595	hsa-miR-106a-5p	Luciferase reporter assay	24704830
MIRT737452	hsa-miR-222-3p	Western blottingImmunohistochemistry (IHC)Flow cytometry	32116235
MIRT755860	hsa-miR-483-5p	Luciferase reporter assayqRT-PCR	35300408
MIRT756081	hsa-miR-149-3p	Luciferase reporter assayWestern blottingqRT-PCRImmunoprecipitaion (IP)	34798882
MIRT1425183	hsa-miR-128	CLIP-seq
MIRT1425184	hsa-miR-129-5p	CLIP-seq
MIRT1425185	hsa-miR-1908	CLIP-seq
MIRT1425186	hsa-miR-214	CLIP-seq
MIRT1425187	hsa-miR-223	CLIP-seq
MIRT1425188	hsa-miR-299-3p	CLIP-seq
MIRT1425189	hsa-miR-3064-3p	CLIP-seq
MIRT1425190	hsa-miR-3119	CLIP-seq
MIRT1425191	hsa-miR-3154	CLIP-seq
MIRT1425192	hsa-miR-3156-5p	CLIP-seq
MIRT1425193	hsa-miR-3166	CLIP-seq
MIRT1425194	hsa-miR-3179	CLIP-seq
MIRT1425195	hsa-miR-3188	CLIP-seq
MIRT1425196	hsa-miR-323b-3p	CLIP-seq
MIRT1425197	hsa-miR-3611	CLIP-seq
MIRT1425198	hsa-miR-3612	CLIP-seq
MIRT1425199	hsa-miR-361-3p	CLIP-seq
MIRT1425200	hsa-miR-3616-3p	CLIP-seq
MIRT1425201	hsa-miR-3619-5p	CLIP-seq
MIRT1425202	hsa-miR-3659	CLIP-seq
MIRT1425203	hsa-miR-3664-3p	CLIP-seq
MIRT1425204	hsa-miR-3687	CLIP-seq
MIRT1425205	hsa-miR-421	CLIP-seq
MIRT1425206	hsa-miR-4252	CLIP-seq
MIRT1425207	hsa-miR-4261	CLIP-seq
MIRT1425208	hsa-miR-4265	CLIP-seq
MIRT1425209	hsa-miR-4291	CLIP-seq
MIRT1425210	hsa-miR-4296	CLIP-seq
MIRT1425211	hsa-miR-432	CLIP-seq
MIRT1425212	hsa-miR-4322	CLIP-seq
MIRT1425213	hsa-miR-4328	CLIP-seq
MIRT1425214	hsa-miR-4417	CLIP-seq
MIRT1425215	hsa-miR-4427	CLIP-seq
MIRT1425216	hsa-miR-4428	CLIP-seq
MIRT1425217	hsa-miR-4433	CLIP-seq
MIRT1425218	hsa-miR-4434	CLIP-seq
MIRT1425219	hsa-miR-4436a	CLIP-seq
MIRT1425220	hsa-miR-4436b-3p	CLIP-seq
MIRT1425221	hsa-miR-4438	CLIP-seq
MIRT1425222	hsa-miR-4442	CLIP-seq
MIRT1425223	hsa-miR-4443	CLIP-seq
MIRT1425224	hsa-miR-4447	CLIP-seq
MIRT1425225	hsa-miR-4472	CLIP-seq
MIRT1425226	hsa-miR-450b-5p	CLIP-seq
MIRT1425227	hsa-miR-4516	CLIP-seq
MIRT1425228	hsa-miR-455-5p	CLIP-seq
MIRT1425229	hsa-miR-4651	CLIP-seq
MIRT1425230	hsa-miR-4658	CLIP-seq
MIRT1425231	hsa-miR-4691-3p	CLIP-seq
MIRT1425232	hsa-miR-4700-3p	CLIP-seq
MIRT1425233	hsa-miR-4709-5p	CLIP-seq
MIRT1425234	hsa-miR-4715-3p	CLIP-seq
MIRT1425235	hsa-miR-4721	CLIP-seq
MIRT1425236	hsa-miR-4723-5p	CLIP-seq
MIRT1425237	hsa-miR-4771	CLIP-seq
MIRT1425238	hsa-miR-4773	CLIP-seq
MIRT1425239	hsa-miR-493	CLIP-seq
MIRT1425240	hsa-miR-507	CLIP-seq
MIRT1425241	hsa-miR-548al	CLIP-seq
MIRT1425242	hsa-miR-550a	CLIP-seq
MIRT1425243	hsa-miR-557	CLIP-seq
MIRT1425244	hsa-miR-574-5p	CLIP-seq
MIRT1425245	hsa-miR-608	CLIP-seq
MIRT1425246	hsa-miR-650	CLIP-seq
MIRT1425247	hsa-miR-663	CLIP-seq
MIRT1425248	hsa-miR-664	CLIP-seq
MIRT1425249	hsa-miR-761	CLIP-seq
MIRT1425250	hsa-miR-922	CLIP-seq
MIRT1554772	hsa-miR-1207-3p	CLIP-seq
MIRT1554773	hsa-miR-1248	CLIP-seq
MIRT1554774	hsa-miR-1253	CLIP-seq
MIRT1554775	hsa-miR-1283	CLIP-seq
MIRT1554776	hsa-miR-1286	CLIP-seq
MIRT1554777	hsa-miR-1291	CLIP-seq
MIRT1554778	hsa-miR-1304	CLIP-seq
MIRT1554779	hsa-miR-1321	CLIP-seq
MIRT1554780	hsa-miR-1343	CLIP-seq
MIRT1554781	hsa-miR-185	CLIP-seq
MIRT1554782	hsa-miR-1913	CLIP-seq
MIRT1554783	hsa-miR-2052	CLIP-seq
MIRT1425186	hsa-miR-214	CLIP-seq
MIRT1554784	hsa-miR-218	CLIP-seq
MIRT1425187	hsa-miR-223	CLIP-seq
MIRT1554785	hsa-miR-24	CLIP-seq
MIRT1554786	hsa-miR-2467-5p	CLIP-seq
MIRT1554787	hsa-miR-3065-3p	CLIP-seq
MIRT1425190	hsa-miR-3119	CLIP-seq
MIRT1554788	hsa-miR-3120-3p	CLIP-seq
MIRT1554789	hsa-miR-3126-5p	CLIP-seq
MIRT1554790	hsa-miR-3156-3p	CLIP-seq
MIRT1554791	hsa-miR-3157-3p	CLIP-seq
MIRT1554792	hsa-miR-3173-5p	CLIP-seq
MIRT1554793	hsa-miR-3192	CLIP-seq
MIRT1554794	hsa-miR-324-3p	CLIP-seq
MIRT1554795	hsa-miR-346	CLIP-seq
MIRT1425197	hsa-miR-3611	CLIP-seq
MIRT1554796	hsa-miR-3614-3p	CLIP-seq
MIRT1425200	hsa-miR-3616-3p	CLIP-seq
MIRT1425201	hsa-miR-3619-5p	CLIP-seq
MIRT1554797	hsa-miR-3647-3p	CLIP-seq
MIRT1425202	hsa-miR-3659	CLIP-seq
MIRT1425203	hsa-miR-3664-3p	CLIP-seq
MIRT1425204	hsa-miR-3687	CLIP-seq
MIRT1554798	hsa-miR-3689a-3p	CLIP-seq
MIRT1554799	hsa-miR-3689c	CLIP-seq
MIRT1554800	hsa-miR-3690	CLIP-seq
MIRT1554801	hsa-miR-4254	CLIP-seq
MIRT1554802	hsa-miR-4257	CLIP-seq
MIRT1425209	hsa-miR-4291	CLIP-seq
MIRT1554803	hsa-miR-4301	CLIP-seq
MIRT1554804	hsa-miR-4306	CLIP-seq
MIRT1554805	hsa-miR-4419a	CLIP-seq
MIRT1554806	hsa-miR-4422	CLIP-seq
MIRT1425217	hsa-miR-4433	CLIP-seq
MIRT1425218	hsa-miR-4434	CLIP-seq
MIRT1425219	hsa-miR-4436a	CLIP-seq
MIRT1425222	hsa-miR-4442	CLIP-seq
MIRT1425223	hsa-miR-4443	CLIP-seq
MIRT1554807	hsa-miR-4510	CLIP-seq
MIRT1425227	hsa-miR-4516	CLIP-seq
MIRT1554808	hsa-miR-4644	CLIP-seq
MIRT1425230	hsa-miR-4658	CLIP-seq
MIRT1554809	hsa-miR-4678	CLIP-seq
MIRT1554810	hsa-miR-4694-3p	CLIP-seq
MIRT1554811	hsa-miR-4697-3p	CLIP-seq
MIRT1425232	hsa-miR-4700-3p	CLIP-seq
MIRT1425234	hsa-miR-4715-3p	CLIP-seq
MIRT1554812	hsa-miR-4722-5p	CLIP-seq
MIRT1554813	hsa-miR-4728-5p	CLIP-seq
MIRT1554814	hsa-miR-4739	CLIP-seq
MIRT1554815	hsa-miR-4756-5p	CLIP-seq
MIRT1554816	hsa-miR-4763-5p	CLIP-seq
MIRT1554817	hsa-miR-4764-5p	CLIP-seq
MIRT1425238	hsa-miR-4773	CLIP-seq
MIRT1554818	hsa-miR-4778-3p	CLIP-seq
MIRT1554819	hsa-miR-4803	CLIP-seq
MIRT1554820	hsa-miR-490-3p	CLIP-seq
MIRT1425239	hsa-miR-493	CLIP-seq
MIRT1554821	hsa-miR-516a-3p	CLIP-seq
MIRT1554822	hsa-miR-532-3p	CLIP-seq
MIRT1425244	hsa-miR-574-5p	CLIP-seq
MIRT1554823	hsa-miR-622	CLIP-seq
MIRT1554824	hsa-miR-624	CLIP-seq
MIRT1554825	hsa-miR-636	CLIP-seq
MIRT1554826	hsa-miR-649	CLIP-seq
MIRT1554827	hsa-miR-671-5p	CLIP-seq
MIRT1554828	hsa-miR-720	CLIP-seq
MIRT1425249	hsa-miR-761	CLIP-seq
MIRT1554829	hsa-miR-764	CLIP-seq
MIRT1425250	hsa-miR-922	CLIP-seq
MIRT1554830	hsa-miR-941	CLIP-seq
MIRT1557183	hsa-miR-1255a	CLIP-seq
MIRT1557184	hsa-miR-1255b	CLIP-seq
MIRT1557185	hsa-miR-3115	CLIP-seq
MIRT1554788	hsa-miR-3120-3p	CLIP-seq
MIRT1557186	hsa-miR-3159	CLIP-seq
MIRT1554798	hsa-miR-3689a-3p	CLIP-seq
MIRT1554799	hsa-miR-3689c	CLIP-seq
MIRT1557187	hsa-miR-3940-5p	CLIP-seq
MIRT1425207	hsa-miR-4261	CLIP-seq
MIRT1557188	hsa-miR-4279	CLIP-seq
MIRT1557189	hsa-miR-4496	CLIP-seq
MIRT1557190	hsa-miR-4507	CLIP-seq
MIRT1554813	hsa-miR-4728-5p	CLIP-seq
MIRT1557191	hsa-miR-552	CLIP-seq
MIRT2127420	hsa-miR-1202	CLIP-seq
MIRT2127421	hsa-miR-1207-5p	CLIP-seq
MIRT2127422	hsa-miR-1208	CLIP-seq
MIRT2127423	hsa-miR-1269	CLIP-seq
MIRT2127424	hsa-miR-1269b	CLIP-seq
MIRT2127425	hsa-miR-1279	CLIP-seq
MIRT1425183	hsa-miR-128	CLIP-seq
MIRT2127426	hsa-miR-1288	CLIP-seq
MIRT1425184	hsa-miR-129-5p	CLIP-seq
MIRT1554779	hsa-miR-1321	CLIP-seq
MIRT2127427	hsa-miR-147	CLIP-seq
MIRT1554781	hsa-miR-185	CLIP-seq
MIRT1425185	hsa-miR-1908	CLIP-seq
MIRT2127428	hsa-miR-1909	CLIP-seq
MIRT2127429	hsa-miR-200b	CLIP-seq
MIRT2127430	hsa-miR-200c	CLIP-seq
MIRT1554785	hsa-miR-24	CLIP-seq
MIRT2127431	hsa-miR-2467-3p	CLIP-seq
MIRT1554786	hsa-miR-2467-5p	CLIP-seq
MIRT2127432	hsa-miR-298	CLIP-seq
MIRT1425188	hsa-miR-299-3p	CLIP-seq
MIRT1554787	hsa-miR-3065-3p	CLIP-seq
MIRT1425190	hsa-miR-3119	CLIP-seq
MIRT1554788	hsa-miR-3120-3p	CLIP-seq
MIRT2127433	hsa-miR-3151	CLIP-seq
MIRT1554790	hsa-miR-3156-3p	CLIP-seq
MIRT1554791	hsa-miR-3157-3p	CLIP-seq
MIRT2127434	hsa-miR-3158-5p	CLIP-seq
MIRT2127435	hsa-miR-3180-5p	CLIP-seq
MIRT1425195	hsa-miR-3188	CLIP-seq
MIRT2127436	hsa-miR-3190	CLIP-seq
MIRT2127437	hsa-miR-3200-5p	CLIP-seq
MIRT2127438	hsa-miR-3202	CLIP-seq
MIRT1425196	hsa-miR-323b-3p	CLIP-seq
MIRT2127439	hsa-miR-338-3p	CLIP-seq
MIRT2127440	hsa-miR-342-5p	CLIP-seq
MIRT1425198	hsa-miR-3612	CLIP-seq
MIRT1554797	hsa-miR-3647-3p	CLIP-seq
MIRT2127441	hsa-miR-3649	CLIP-seq
MIRT1425202	hsa-miR-3659	CLIP-seq
MIRT2127442	hsa-miR-3678-3p	CLIP-seq
MIRT1554798	hsa-miR-3689a-3p	CLIP-seq
MIRT1554799	hsa-miR-3689c	CLIP-seq
MIRT1554800	hsa-miR-3690	CLIP-seq
MIRT2127443	hsa-miR-374c	CLIP-seq
MIRT2127444	hsa-miR-3972	CLIP-seq
MIRT1425205	hsa-miR-421	CLIP-seq
MIRT1425206	hsa-miR-4252	CLIP-seq
MIRT1554801	hsa-miR-4254	CLIP-seq
MIRT1554802	hsa-miR-4257	CLIP-seq
MIRT1425207	hsa-miR-4261	CLIP-seq
MIRT2127445	hsa-miR-4270	CLIP-seq
MIRT2127446	hsa-miR-4300	CLIP-seq
MIRT1554803	hsa-miR-4301	CLIP-seq
MIRT1554804	hsa-miR-4306	CLIP-seq
MIRT2127447	hsa-miR-4330	CLIP-seq
MIRT1554805	hsa-miR-4419a	CLIP-seq
MIRT1554806	hsa-miR-4422	CLIP-seq
MIRT2127448	hsa-miR-4441	CLIP-seq
MIRT1425223	hsa-miR-4443	CLIP-seq
MIRT1425224	hsa-miR-4447	CLIP-seq
MIRT1425225	hsa-miR-4472	CLIP-seq
MIRT2127449	hsa-miR-4475	CLIP-seq
MIRT2127450	hsa-miR-4476	CLIP-seq
MIRT2127451	hsa-miR-4494	CLIP-seq
MIRT1557189	hsa-miR-4496	CLIP-seq
MIRT1425226	hsa-miR-450b-5p	CLIP-seq
MIRT1554807	hsa-miR-4510	CLIP-seq
MIRT2127452	hsa-miR-4515	CLIP-seq
MIRT2127453	hsa-miR-4530	CLIP-seq
MIRT1554808	hsa-miR-4644	CLIP-seq
MIRT2127454	hsa-miR-4645-5p	CLIP-seq
MIRT1425229	hsa-miR-4651	CLIP-seq
MIRT1425230	hsa-miR-4658	CLIP-seq
MIRT2127455	hsa-miR-4664-5p	CLIP-seq
MIRT2127456	hsa-miR-4673	CLIP-seq
MIRT2127457	hsa-miR-4688	CLIP-seq
MIRT1554810	hsa-miR-4694-3p	CLIP-seq
MIRT2127458	hsa-miR-4694-5p	CLIP-seq
MIRT1425232	hsa-miR-4700-3p	CLIP-seq
MIRT2127459	hsa-miR-4717-3p	CLIP-seq
MIRT1425236	hsa-miR-4723-5p	CLIP-seq
MIRT1554813	hsa-miR-4728-5p	CLIP-seq
MIRT1554814	hsa-miR-4739	CLIP-seq
MIRT2127460	hsa-miR-4740-5p	CLIP-seq
MIRT2127461	hsa-miR-4755-3p	CLIP-seq
MIRT1554815	hsa-miR-4756-5p	CLIP-seq
MIRT2127462	hsa-miR-4763-3p	CLIP-seq
MIRT1554817	hsa-miR-4764-5p	CLIP-seq
MIRT2127463	hsa-miR-4802-3p	CLIP-seq
MIRT2127464	hsa-miR-486-3p	CLIP-seq
MIRT2127465	hsa-miR-491-5p	CLIP-seq
MIRT1425239	hsa-miR-493	CLIP-seq
MIRT2127466	hsa-miR-499a-5p	CLIP-seq
MIRT1425240	hsa-miR-507	CLIP-seq
MIRT2127467	hsa-miR-513c	CLIP-seq
MIRT2127468	hsa-miR-514b-5p	CLIP-seq
MIRT2127469	hsa-miR-519a	CLIP-seq
MIRT2127470	hsa-miR-519b-3p	CLIP-seq
MIRT1554822	hsa-miR-532-3p	CLIP-seq
MIRT2127471	hsa-miR-544	CLIP-seq
MIRT1425242	hsa-miR-550a	CLIP-seq
MIRT1557191	hsa-miR-552	CLIP-seq
MIRT1425243	hsa-miR-557	CLIP-seq
MIRT2127472	hsa-miR-570	CLIP-seq
MIRT1425244	hsa-miR-574-5p	CLIP-seq
MIRT2127473	hsa-miR-581	CLIP-seq
MIRT1425245	hsa-miR-608	CLIP-seq
MIRT2127474	hsa-miR-609	CLIP-seq
MIRT1554823	hsa-miR-622	CLIP-seq
MIRT2127475	hsa-miR-642a	CLIP-seq
MIRT1425246	hsa-miR-650	CLIP-seq
MIRT2127476	hsa-miR-655	CLIP-seq
MIRT2127477	hsa-miR-661	CLIP-seq
MIRT1425247	hsa-miR-663	CLIP-seq
MIRT1425248	hsa-miR-664	CLIP-seq
MIRT2127478	hsa-miR-665	CLIP-seq
MIRT1554827	hsa-miR-671-5p	CLIP-seq
MIRT2127479	hsa-miR-920	CLIP-seq
MIRT2127480	hsa-miR-938	CLIP-seq
MIRT2349231	hsa-miR-153	CLIP-seq
MIRT1425185	hsa-miR-1908	CLIP-seq
MIRT1554787	hsa-miR-3065-3p	CLIP-seq
MIRT1554791	hsa-miR-3157-3p	CLIP-seq
MIRT2127440	hsa-miR-342-5p	CLIP-seq
MIRT1425205	hsa-miR-421	CLIP-seq
MIRT1425217	hsa-miR-4433	CLIP-seq
MIRT1425224	hsa-miR-4447	CLIP-seq
MIRT1425225	hsa-miR-4472	CLIP-seq
MIRT1425229	hsa-miR-4651	CLIP-seq
MIRT2127455	hsa-miR-4664-5p	CLIP-seq
MIRT2127458	hsa-miR-4694-5p	CLIP-seq
MIRT1425233	hsa-miR-4709-5p	CLIP-seq
MIRT2349232	hsa-miR-4717-5p	CLIP-seq
MIRT1425239	hsa-miR-493	CLIP-seq
MIRT2349233	hsa-miR-505	CLIP-seq
MIRT1554821	hsa-miR-516a-3p	CLIP-seq
MIRT1425241	hsa-miR-548al	CLIP-seq
MIRT1425242	hsa-miR-550a	CLIP-seq
MIRT1425245	hsa-miR-608	CLIP-seq
MIRT2127474	hsa-miR-609	CLIP-seq
MIRT1554823	hsa-miR-622	CLIP-seq
MIRT1425247	hsa-miR-663	CLIP-seq
MIRT1554772	hsa-miR-1207-3p	CLIP-seq
MIRT2127421	hsa-miR-1207-5p	CLIP-seq
MIRT2127422	hsa-miR-1208	CLIP-seq
MIRT2395805	hsa-miR-125a-3p	CLIP-seq
MIRT1425185	hsa-miR-1908	CLIP-seq
MIRT2395806	hsa-miR-2964a-5p	CLIP-seq
MIRT1425188	hsa-miR-299-3p	CLIP-seq
MIRT1557185	hsa-miR-3115	CLIP-seq
MIRT1554788	hsa-miR-3120-3p	CLIP-seq
MIRT2127433	hsa-miR-3151	CLIP-seq
MIRT1425193	hsa-miR-3166	CLIP-seq
MIRT1554792	hsa-miR-3173-5p	CLIP-seq
MIRT1425195	hsa-miR-3188	CLIP-seq
MIRT1554793	hsa-miR-3192	CLIP-seq
MIRT2127438	hsa-miR-3202	CLIP-seq
MIRT2127440	hsa-miR-342-5p	CLIP-seq
MIRT2395807	hsa-miR-3613-3p	CLIP-seq
MIRT1554798	hsa-miR-3689a-3p	CLIP-seq
MIRT1554799	hsa-miR-3689c	CLIP-seq
MIRT2395808	hsa-miR-3934	CLIP-seq
MIRT1557187	hsa-miR-3940-5p	CLIP-seq
MIRT2395809	hsa-miR-4317	CLIP-seq
MIRT1425223	hsa-miR-4443	CLIP-seq
MIRT1425224	hsa-miR-4447	CLIP-seq
MIRT1425225	hsa-miR-4472	CLIP-seq
MIRT1557190	hsa-miR-4507	CLIP-seq
MIRT1425226	hsa-miR-450b-5p	CLIP-seq
MIRT1425229	hsa-miR-4651	CLIP-seq
MIRT2127455	hsa-miR-4664-5p	CLIP-seq
MIRT2395810	hsa-miR-4668-3p	CLIP-seq
MIRT2127458	hsa-miR-4694-5p	CLIP-seq
MIRT2395811	hsa-miR-4696	CLIP-seq
MIRT1425232	hsa-miR-4700-3p	CLIP-seq
MIRT1425236	hsa-miR-4723-5p	CLIP-seq
MIRT1554813	hsa-miR-4728-5p	CLIP-seq
MIRT2127462	hsa-miR-4763-3p	CLIP-seq
MIRT1554817	hsa-miR-4764-5p	CLIP-seq
MIRT1425237	hsa-miR-4771	CLIP-seq
MIRT2395812	hsa-miR-4776-5p	CLIP-seq
MIRT2127465	hsa-miR-491-5p	CLIP-seq
MIRT1425240	hsa-miR-507	CLIP-seq
MIRT2395813	hsa-miR-548c-3p	CLIP-seq
MIRT1425243	hsa-miR-557	CLIP-seq
MIRT2127472	hsa-miR-570	CLIP-seq
MIRT1425245	hsa-miR-608	CLIP-seq
MIRT2127474	hsa-miR-609	CLIP-seq
MIRT1425247	hsa-miR-663	CLIP-seq
MIRT1554827	hsa-miR-671-5p	CLIP-seq
MIRT1554829	hsa-miR-764	CLIP-seq
MIRT2127420	hsa-miR-1202	CLIP-seq
MIRT2127422	hsa-miR-1208	CLIP-seq
MIRT2433925	hsa-miR-1228	CLIP-seq
MIRT1554773	hsa-miR-1248	CLIP-seq
MIRT1554774	hsa-miR-1253	CLIP-seq
MIRT2395805	hsa-miR-125a-3p	CLIP-seq
MIRT2127423	hsa-miR-1269	CLIP-seq
MIRT2127424	hsa-miR-1269b	CLIP-seq
MIRT2433926	hsa-miR-1273e	CLIP-seq
MIRT2433927	hsa-miR-1275	CLIP-seq
MIRT1554776	hsa-miR-1286	CLIP-seq
MIRT2127426	hsa-miR-1288	CLIP-seq
MIRT1425184	hsa-miR-129-5p	CLIP-seq
MIRT1554778	hsa-miR-1304	CLIP-seq
MIRT2433928	hsa-miR-1305	CLIP-seq
MIRT2433929	hsa-miR-142-5p	CLIP-seq
MIRT2127427	hsa-miR-147	CLIP-seq
MIRT1554781	hsa-miR-185	CLIP-seq
MIRT2433930	hsa-miR-1973	CLIP-seq
MIRT2127429	hsa-miR-200b	CLIP-seq
MIRT2127430	hsa-miR-200c	CLIP-seq
MIRT1554783	hsa-miR-2052	CLIP-seq
MIRT1425186	hsa-miR-214	CLIP-seq
MIRT1554784	hsa-miR-218	CLIP-seq
MIRT2433931	hsa-miR-219-1-3p	CLIP-seq
MIRT1425187	hsa-miR-223	CLIP-seq
MIRT2433932	hsa-miR-2276	CLIP-seq
MIRT2395806	hsa-miR-2964a-5p	CLIP-seq
MIRT2127432	hsa-miR-298	CLIP-seq
MIRT1425188	hsa-miR-299-3p	CLIP-seq
MIRT2433933	hsa-miR-300	CLIP-seq
MIRT2433934	hsa-miR-3065-5p	CLIP-seq
MIRT2433935	hsa-miR-30a	CLIP-seq
MIRT2433936	hsa-miR-30b	CLIP-seq
MIRT2433937	hsa-miR-30c	CLIP-seq
MIRT2433938	hsa-miR-30d	CLIP-seq
MIRT2433939	hsa-miR-30e	CLIP-seq
MIRT1557185	hsa-miR-3115	CLIP-seq
MIRT1425190	hsa-miR-3119	CLIP-seq
MIRT1554789	hsa-miR-3126-5p	CLIP-seq
MIRT2127433	hsa-miR-3151	CLIP-seq
MIRT2433940	hsa-miR-3165	CLIP-seq
MIRT2433941	hsa-miR-3170	CLIP-seq
MIRT2127435	hsa-miR-3180-5p	CLIP-seq
MIRT1425195	hsa-miR-3188	CLIP-seq
MIRT1554793	hsa-miR-3192	CLIP-seq
MIRT2127437	hsa-miR-3200-5p	CLIP-seq
MIRT2127438	hsa-miR-3202	CLIP-seq
MIRT1425196	hsa-miR-323b-3p	CLIP-seq
MIRT2433942	hsa-miR-330-3p	CLIP-seq
MIRT2433943	hsa-miR-340	CLIP-seq
MIRT2127440	hsa-miR-342-5p	CLIP-seq
MIRT2433944	hsa-miR-34c-3p	CLIP-seq
MIRT2433945	hsa-miR-3545-3p	CLIP-seq
MIRT1425197	hsa-miR-3611	CLIP-seq
MIRT1425198	hsa-miR-3612	CLIP-seq
MIRT2395807	hsa-miR-3613-3p	CLIP-seq
MIRT1554796	hsa-miR-3614-3p	CLIP-seq
MIRT2433946	hsa-miR-3614-5p	CLIP-seq
MIRT2433947	hsa-miR-3619-3p	CLIP-seq
MIRT1425201	hsa-miR-3619-5p	CLIP-seq
MIRT1554797	hsa-miR-3647-3p	CLIP-seq
MIRT2433948	hsa-miR-3670	CLIP-seq
MIRT2127443	hsa-miR-374c	CLIP-seq
MIRT2433949	hsa-miR-381	CLIP-seq
MIRT2433950	hsa-miR-3913-3p	CLIP-seq
MIRT2433951	hsa-miR-3919	CLIP-seq
MIRT2395808	hsa-miR-3934	CLIP-seq
MIRT1557187	hsa-miR-3940-5p	CLIP-seq
MIRT2433952	hsa-miR-3942-3p	CLIP-seq
MIRT2127444	hsa-miR-3972	CLIP-seq
MIRT1425205	hsa-miR-421	CLIP-seq
MIRT2433953	hsa-miR-425	CLIP-seq
MIRT2433954	hsa-miR-4251	CLIP-seq
MIRT1425206	hsa-miR-4252	CLIP-seq
MIRT2433955	hsa-miR-4260	CLIP-seq
MIRT1425207	hsa-miR-4261	CLIP-seq
MIRT1425209	hsa-miR-4291	CLIP-seq
MIRT2433956	hsa-miR-4294	CLIP-seq
MIRT2433957	hsa-miR-4299	CLIP-seq
MIRT2127446	hsa-miR-4300	CLIP-seq
MIRT1554804	hsa-miR-4306	CLIP-seq
MIRT1425211	hsa-miR-432	CLIP-seq
MIRT2433958	hsa-miR-4327	CLIP-seq
MIRT2433959	hsa-miR-4329	CLIP-seq
MIRT1554805	hsa-miR-4419a	CLIP-seq
MIRT1554806	hsa-miR-4422	CLIP-seq
MIRT1425217	hsa-miR-4433	CLIP-seq
MIRT1425218	hsa-miR-4434	CLIP-seq
MIRT1425223	hsa-miR-4443	CLIP-seq
MIRT1425224	hsa-miR-4447	CLIP-seq
MIRT2433960	hsa-miR-4456	CLIP-seq
MIRT2433961	hsa-miR-4459	CLIP-seq
MIRT1425225	hsa-miR-4472	CLIP-seq
MIRT2127450	hsa-miR-4476	CLIP-seq
MIRT2433962	hsa-miR-4484	CLIP-seq
MIRT2433963	hsa-miR-4487	CLIP-seq
MIRT2433964	hsa-miR-4495	CLIP-seq
MIRT1557189	hsa-miR-4496	CLIP-seq
MIRT1557190	hsa-miR-4507	CLIP-seq
MIRT1425226	hsa-miR-450b-5p	CLIP-seq
MIRT1554807	hsa-miR-4510	CLIP-seq
MIRT2127452	hsa-miR-4515	CLIP-seq
MIRT1425227	hsa-miR-4516	CLIP-seq
MIRT1554808	hsa-miR-4644	CLIP-seq
MIRT2127454	hsa-miR-4645-5p	CLIP-seq
MIRT1425229	hsa-miR-4651	CLIP-seq
MIRT2433965	hsa-miR-4653-3p	CLIP-seq
MIRT2433966	hsa-miR-4655-5p	CLIP-seq
MIRT2127455	hsa-miR-4664-5p	CLIP-seq
MIRT2433967	hsa-miR-4665-5p	CLIP-seq
MIRT2127456	hsa-miR-4673	CLIP-seq
MIRT1554809	hsa-miR-4678	CLIP-seq
MIRT2433968	hsa-miR-4686	CLIP-seq
MIRT2433969	hsa-miR-4687-3p	CLIP-seq
MIRT1554810	hsa-miR-4694-3p	CLIP-seq
MIRT2127458	hsa-miR-4694-5p	CLIP-seq
MIRT1554811	hsa-miR-4697-3p	CLIP-seq
MIRT1425232	hsa-miR-4700-3p	CLIP-seq
MIRT1425233	hsa-miR-4709-5p	CLIP-seq
MIRT2433970	hsa-miR-4711-5p	CLIP-seq
MIRT2127459	hsa-miR-4717-3p	CLIP-seq
MIRT2349232	hsa-miR-4717-5p	CLIP-seq
MIRT1554812	hsa-miR-4722-5p	CLIP-seq
MIRT1425236	hsa-miR-4723-5p	CLIP-seq
MIRT2433971	hsa-miR-4731-5p	CLIP-seq
MIRT2127460	hsa-miR-4740-5p	CLIP-seq
MIRT2433972	hsa-miR-4753-5p	CLIP-seq
MIRT2127461	hsa-miR-4755-3p	CLIP-seq
MIRT2433973	hsa-miR-4756-3p	CLIP-seq
MIRT1554817	hsa-miR-4764-5p	CLIP-seq
MIRT2433974	hsa-miR-4768-3p	CLIP-seq
MIRT2433975	hsa-miR-4772-3p	CLIP-seq
MIRT1425238	hsa-miR-4773	CLIP-seq
MIRT2395812	hsa-miR-4776-5p	CLIP-seq
MIRT1554818	hsa-miR-4778-3p	CLIP-seq
MIRT2433976	hsa-miR-4789-3p	CLIP-seq
MIRT2127463	hsa-miR-4802-3p	CLIP-seq
MIRT1554819	hsa-miR-4803	CLIP-seq
MIRT2433977	hsa-miR-489	CLIP-seq
MIRT1554820	hsa-miR-490-3p	CLIP-seq
MIRT2127465	hsa-miR-491-5p	CLIP-seq
MIRT1425239	hsa-miR-493	CLIP-seq
MIRT2433978	hsa-miR-495	CLIP-seq
MIRT2433979	hsa-miR-501-5p	CLIP-seq
MIRT2349233	hsa-miR-505	CLIP-seq
MIRT1425240	hsa-miR-507	CLIP-seq
MIRT2433980	hsa-miR-510	CLIP-seq
MIRT2433981	hsa-miR-520d-5p	CLIP-seq
MIRT2433982	hsa-miR-524-5p	CLIP-seq
MIRT2433983	hsa-miR-541	CLIP-seq
MIRT1425241	hsa-miR-548al	CLIP-seq
MIRT2433984	hsa-miR-548an	CLIP-seq
MIRT2433985	hsa-miR-548q	CLIP-seq
MIRT1557191	hsa-miR-552	CLIP-seq
MIRT1425243	hsa-miR-557	CLIP-seq
MIRT2433986	hsa-miR-568	CLIP-seq
MIRT2433987	hsa-miR-571	CLIP-seq
MIRT2433988	hsa-miR-580	CLIP-seq
MIRT2127473	hsa-miR-581	CLIP-seq
MIRT2433989	hsa-miR-606	CLIP-seq
MIRT1425245	hsa-miR-608	CLIP-seq
MIRT2127474	hsa-miR-609	CLIP-seq
MIRT2433990	hsa-miR-616	CLIP-seq
MIRT1554823	hsa-miR-622	CLIP-seq
MIRT1554825	hsa-miR-636	CLIP-seq
MIRT1554826	hsa-miR-649	CLIP-seq
MIRT1425246	hsa-miR-650	CLIP-seq
MIRT2433991	hsa-miR-654-5p	CLIP-seq
MIRT2127476	hsa-miR-655	CLIP-seq
MIRT2127478	hsa-miR-665	CLIP-seq
MIRT1425249	hsa-miR-761	CLIP-seq
MIRT1554829	hsa-miR-764	CLIP-seq
MIRT2433992	hsa-miR-873	CLIP-seq
MIRT2433993	hsa-miR-885-5p	CLIP-seq
MIRT2433994	hsa-miR-888	CLIP-seq
MIRT2433995	hsa-miR-891b	CLIP-seq
MIRT2433996	hsa-miR-892b	CLIP-seq
MIRT2127479	hsa-miR-920	CLIP-seq
MIRT1425250	hsa-miR-922	CLIP-seq
MIRT2433997	hsa-miR-924	CLIP-seq
MIRT2127480	hsa-miR-938	CLIP-seq
MIRT1554830	hsa-miR-941	CLIP-seq
MIRT1425205	hsa-miR-421	CLIP-seq
MIRT1425223	hsa-miR-4443	CLIP-seq
MIRT2127421	hsa-miR-1207-5p	CLIP-seq
MIRT2127422	hsa-miR-1208	CLIP-seq
MIRT2441110	hsa-miR-1224-5p	CLIP-seq
MIRT1557183	hsa-miR-1255a	CLIP-seq
MIRT1557184	hsa-miR-1255b	CLIP-seq
MIRT2441111	hsa-miR-1265	CLIP-seq
MIRT1554777	hsa-miR-1291	CLIP-seq
MIRT2433928	hsa-miR-1305	CLIP-seq
MIRT1554779	hsa-miR-1321	CLIP-seq
MIRT2127427	hsa-miR-147	CLIP-seq
MIRT2441112	hsa-miR-1470	CLIP-seq
MIRT1554783	hsa-miR-2052	CLIP-seq
MIRT2441113	hsa-miR-2392	CLIP-seq
MIRT2127431	hsa-miR-2467-3p	CLIP-seq
MIRT2127432	hsa-miR-298	CLIP-seq
MIRT1554787	hsa-miR-3065-3p	CLIP-seq
MIRT2433934	hsa-miR-3065-5p	CLIP-seq
MIRT1554788	hsa-miR-3120-3p	CLIP-seq
MIRT2441114	hsa-miR-3150a-3p	CLIP-seq
MIRT2127433	hsa-miR-3151	CLIP-seq
MIRT2127434	hsa-miR-3158-5p	CLIP-seq
MIRT1554792	hsa-miR-3173-5p	CLIP-seq
MIRT2441115	hsa-miR-3175	CLIP-seq
MIRT2127436	hsa-miR-3190	CLIP-seq
MIRT1554793	hsa-miR-3192	CLIP-seq
MIRT2433942	hsa-miR-330-3p	CLIP-seq
MIRT2441116	hsa-miR-3605-5p	CLIP-seq
MIRT1425197	hsa-miR-3611	CLIP-seq
MIRT1425200	hsa-miR-3616-3p	CLIP-seq
MIRT1425203	hsa-miR-3664-3p	CLIP-seq
MIRT2441117	hsa-miR-3667-5p	CLIP-seq
MIRT2127442	hsa-miR-3678-3p	CLIP-seq
MIRT1554798	hsa-miR-3689a-3p	CLIP-seq
MIRT1554799	hsa-miR-3689c	CLIP-seq
MIRT2441118	hsa-miR-3909	CLIP-seq
MIRT2433950	hsa-miR-3913-3p	CLIP-seq
MIRT2433951	hsa-miR-3919	CLIP-seq
MIRT2441119	hsa-miR-3944-5p	CLIP-seq
MIRT1425205	hsa-miR-421	CLIP-seq
MIRT1425206	hsa-miR-4252	CLIP-seq
MIRT1425207	hsa-miR-4261	CLIP-seq
MIRT2127445	hsa-miR-4270	CLIP-seq
MIRT2441120	hsa-miR-4287	CLIP-seq
MIRT1554805	hsa-miR-4419a	CLIP-seq
MIRT1554806	hsa-miR-4422	CLIP-seq
MIRT2127448	hsa-miR-4441	CLIP-seq
MIRT1425223	hsa-miR-4443	CLIP-seq
MIRT2441121	hsa-miR-4469	CLIP-seq
MIRT1554807	hsa-miR-4510	CLIP-seq
MIRT2441122	hsa-miR-451b	CLIP-seq
MIRT2441123	hsa-miR-4535	CLIP-seq
MIRT2441124	hsa-miR-4652-3p	CLIP-seq
MIRT2441125	hsa-miR-4667-3p	CLIP-seq
MIRT1554809	hsa-miR-4678	CLIP-seq
MIRT2441126	hsa-miR-4685-3p	CLIP-seq
MIRT2395811	hsa-miR-4696	CLIP-seq
MIRT1425233	hsa-miR-4709-5p	CLIP-seq
MIRT2433970	hsa-miR-4711-5p	CLIP-seq
MIRT1425234	hsa-miR-4715-3p	CLIP-seq
MIRT1554813	hsa-miR-4728-5p	CLIP-seq
MIRT1554814	hsa-miR-4739	CLIP-seq
MIRT2441127	hsa-miR-4751	CLIP-seq
MIRT2433973	hsa-miR-4756-3p	CLIP-seq
MIRT1554815	hsa-miR-4756-5p	CLIP-seq
MIRT2127462	hsa-miR-4763-3p	CLIP-seq
MIRT1554817	hsa-miR-4764-5p	CLIP-seq
MIRT2395812	hsa-miR-4776-5p	CLIP-seq
MIRT1554818	hsa-miR-4778-3p	CLIP-seq
MIRT2127464	hsa-miR-486-3p	CLIP-seq
MIRT2433977	hsa-miR-489	CLIP-seq
MIRT1554820	hsa-miR-490-3p	CLIP-seq
MIRT1425239	hsa-miR-493	CLIP-seq
MIRT2349233	hsa-miR-505	CLIP-seq
MIRT2433981	hsa-miR-520d-5p	CLIP-seq
MIRT2433982	hsa-miR-524-5p	CLIP-seq
MIRT2127471	hsa-miR-544	CLIP-seq
MIRT2127472	hsa-miR-570	CLIP-seq
MIRT2127473	hsa-miR-581	CLIP-seq
MIRT1554823	hsa-miR-622	CLIP-seq
MIRT1554826	hsa-miR-649	CLIP-seq
MIRT2127477	hsa-miR-661	CLIP-seq
MIRT2441128	hsa-miR-662	CLIP-seq
MIRT1554827	hsa-miR-671-5p	CLIP-seq
MIRT2441129	hsa-miR-711	CLIP-seq
MIRT2441130	hsa-miR-767-3p	CLIP-seq
MIRT2441131	hsa-miR-939	CLIP-seq
MIRT1554830	hsa-miR-941	CLIP-seq
MIRT1554783	hsa-miR-2052	CLIP-seq
MIRT1425234	hsa-miR-4715-3p	CLIP-seq
MIRT1554818	hsa-miR-4778-3p	CLIP-seq
MIRT1554820	hsa-miR-490-3p	CLIP-seq
MIRT1554826	hsa-miR-649	CLIP-seq
MIRT1554830	hsa-miR-941	CLIP-seq
MIRT2127421	hsa-miR-1207-5p	CLIP-seq
MIRT2127422	hsa-miR-1208	CLIP-seq
MIRT2433925	hsa-miR-1228	CLIP-seq
MIRT2127423	hsa-miR-1269	CLIP-seq
MIRT2127424	hsa-miR-1269b	CLIP-seq
MIRT2433926	hsa-miR-1273e	CLIP-seq
MIRT2433927	hsa-miR-1275	CLIP-seq
MIRT2127425	hsa-miR-1279	CLIP-seq
MIRT1425183	hsa-miR-128	CLIP-seq
MIRT1554776	hsa-miR-1286	CLIP-seq
MIRT2127426	hsa-miR-1288	CLIP-seq
MIRT2433928	hsa-miR-1305	CLIP-seq
MIRT1554780	hsa-miR-1343	CLIP-seq
MIRT2433929	hsa-miR-142-5p	CLIP-seq
MIRT2127427	hsa-miR-147	CLIP-seq
MIRT2642573	hsa-miR-18a	CLIP-seq
MIRT2642574	hsa-miR-18b	CLIP-seq
MIRT2127428	hsa-miR-1909	CLIP-seq
MIRT2642575	hsa-miR-191	CLIP-seq
MIRT1554782	hsa-miR-1913	CLIP-seq
MIRT2127429	hsa-miR-200b	CLIP-seq
MIRT2127430	hsa-miR-200c	CLIP-seq
MIRT1554783	hsa-miR-2052	CLIP-seq
MIRT2433931	hsa-miR-219-1-3p	CLIP-seq
MIRT2127432	hsa-miR-298	CLIP-seq
MIRT2433933	hsa-miR-300	CLIP-seq
MIRT1554787	hsa-miR-3065-3p	CLIP-seq
MIRT2433934	hsa-miR-3065-5p	CLIP-seq
MIRT2433935	hsa-miR-30a	CLIP-seq
MIRT2433936	hsa-miR-30b	CLIP-seq
MIRT2433937	hsa-miR-30c	CLIP-seq
MIRT2433938	hsa-miR-30d	CLIP-seq
MIRT2433939	hsa-miR-30e	CLIP-seq
MIRT1425190	hsa-miR-3119	CLIP-seq
MIRT1554788	hsa-miR-3120-3p	CLIP-seq
MIRT2642576	hsa-miR-3133	CLIP-seq
MIRT2127433	hsa-miR-3151	CLIP-seq
MIRT1425192	hsa-miR-3156-5p	CLIP-seq
MIRT1554791	hsa-miR-3157-3p	CLIP-seq
MIRT2433941	hsa-miR-3170	CLIP-seq
MIRT1425196	hsa-miR-323b-3p	CLIP-seq
MIRT1554794	hsa-miR-324-3p	CLIP-seq
MIRT2433942	hsa-miR-330-3p	CLIP-seq
MIRT2127439	hsa-miR-338-3p	CLIP-seq
MIRT2433943	hsa-miR-340	CLIP-seq
MIRT1554795	hsa-miR-346	CLIP-seq
MIRT2433945	hsa-miR-3545-3p	CLIP-seq
MIRT1425199	hsa-miR-361-3p	CLIP-seq
MIRT2433946	hsa-miR-3614-5p	CLIP-seq
MIRT2642577	hsa-miR-3622b-5p	CLIP-seq
MIRT1554797	hsa-miR-3647-3p	CLIP-seq
MIRT2642578	hsa-miR-3671	CLIP-seq
MIRT1554800	hsa-miR-3690	CLIP-seq
MIRT2642579	hsa-miR-3691-5p	CLIP-seq
MIRT2127443	hsa-miR-374c	CLIP-seq
MIRT2433949	hsa-miR-381	CLIP-seq
MIRT2642580	hsa-miR-3911	CLIP-seq
MIRT2433950	hsa-miR-3913-3p	CLIP-seq
MIRT2433951	hsa-miR-3919	CLIP-seq
MIRT2433952	hsa-miR-3942-3p	CLIP-seq
MIRT2642581	hsa-miR-3945	CLIP-seq
MIRT1425205	hsa-miR-421	CLIP-seq
MIRT2433953	hsa-miR-425	CLIP-seq
MIRT1425206	hsa-miR-4252	CLIP-seq
MIRT2642582	hsa-miR-4253	CLIP-seq
MIRT1554801	hsa-miR-4254	CLIP-seq
MIRT2433955	hsa-miR-4260	CLIP-seq
MIRT1425207	hsa-miR-4261	CLIP-seq
MIRT2642583	hsa-miR-4281	CLIP-seq
MIRT2433956	hsa-miR-4294	CLIP-seq
MIRT2433958	hsa-miR-4327	CLIP-seq
MIRT2127447	hsa-miR-4330	CLIP-seq
MIRT1554806	hsa-miR-4422	CLIP-seq
MIRT1425215	hsa-miR-4427	CLIP-seq
MIRT1425217	hsa-miR-4433	CLIP-seq
MIRT1425218	hsa-miR-4434	CLIP-seq
MIRT1425221	hsa-miR-4438	CLIP-seq
MIRT2642584	hsa-miR-4449	CLIP-seq
MIRT2433961	hsa-miR-4459	CLIP-seq
MIRT2433962	hsa-miR-4484	CLIP-seq
MIRT2642585	hsa-miR-4488	CLIP-seq
MIRT2127451	hsa-miR-4494	CLIP-seq
MIRT2433964	hsa-miR-4495	CLIP-seq
MIRT1425226	hsa-miR-450b-5p	CLIP-seq
MIRT2127452	hsa-miR-4515	CLIP-seq
MIRT1425227	hsa-miR-4516	CLIP-seq
MIRT2127453	hsa-miR-4530	CLIP-seq
MIRT2642586	hsa-miR-4531	CLIP-seq
MIRT2433967	hsa-miR-4665-5p	CLIP-seq
MIRT2395810	hsa-miR-4668-3p	CLIP-seq
MIRT2395811	hsa-miR-4696	CLIP-seq
MIRT2642587	hsa-miR-4697-5p	CLIP-seq
MIRT1425233	hsa-miR-4709-5p	CLIP-seq
MIRT2433970	hsa-miR-4711-5p	CLIP-seq
MIRT1425234	hsa-miR-4715-3p	CLIP-seq
MIRT2127459	hsa-miR-4717-3p	CLIP-seq
MIRT2349232	hsa-miR-4717-5p	CLIP-seq
MIRT1554812	hsa-miR-4722-5p	CLIP-seq
MIRT2642588	hsa-miR-4735-3p	CLIP-seq
MIRT2127460	hsa-miR-4740-5p	CLIP-seq
MIRT2642589	hsa-miR-4752	CLIP-seq
MIRT2433972	hsa-miR-4753-5p	CLIP-seq
MIRT2433973	hsa-miR-4756-3p	CLIP-seq
MIRT2127462	hsa-miR-4763-3p	CLIP-seq
MIRT2433974	hsa-miR-4768-3p	CLIP-seq
MIRT1425238	hsa-miR-4773	CLIP-seq
MIRT1554818	hsa-miR-4778-3p	CLIP-seq
MIRT2642590	hsa-miR-4783-3p	CLIP-seq
MIRT2127463	hsa-miR-4802-3p	CLIP-seq
MIRT2127464	hsa-miR-486-3p	CLIP-seq
MIRT2433977	hsa-miR-489	CLIP-seq
MIRT1554820	hsa-miR-490-3p	CLIP-seq
MIRT1425239	hsa-miR-493	CLIP-seq
MIRT2127466	hsa-miR-499a-5p	CLIP-seq
MIRT2433979	hsa-miR-501-5p	CLIP-seq
MIRT2349233	hsa-miR-505	CLIP-seq
MIRT1425240	hsa-miR-507	CLIP-seq
MIRT2433981	hsa-miR-520d-5p	CLIP-seq
MIRT2433982	hsa-miR-524-5p	CLIP-seq
MIRT2433983	hsa-miR-541	CLIP-seq
MIRT2127471	hsa-miR-544	CLIP-seq
MIRT1425241	hsa-miR-548al	CLIP-seq
MIRT2433984	hsa-miR-548an	CLIP-seq
MIRT2395813	hsa-miR-548c-3p	CLIP-seq
MIRT1557191	hsa-miR-552	CLIP-seq
MIRT1425243	hsa-miR-557	CLIP-seq
MIRT2127472	hsa-miR-570	CLIP-seq
MIRT2433987	hsa-miR-571	CLIP-seq
MIRT2127473	hsa-miR-581	CLIP-seq
MIRT2642591	hsa-miR-589	CLIP-seq
MIRT2433989	hsa-miR-606	CLIP-seq
MIRT1554823	hsa-miR-622	CLIP-seq
MIRT2642592	hsa-miR-628-5p	CLIP-seq
MIRT2642593	hsa-miR-644	CLIP-seq
MIRT1554826	hsa-miR-649	CLIP-seq
MIRT2433991	hsa-miR-654-5p	CLIP-seq
MIRT2127476	hsa-miR-655	CLIP-seq
MIRT1554827	hsa-miR-671-5p	CLIP-seq
MIRT1554829	hsa-miR-764	CLIP-seq
MIRT2441130	hsa-miR-767-3p	CLIP-seq
MIRT2433993	hsa-miR-885-5p	CLIP-seq
MIRT2433994	hsa-miR-888	CLIP-seq
MIRT2433997	hsa-miR-924	CLIP-seq
MIRT1554830	hsa-miR-941	CLIP-seq
MIRT2127421	hsa-miR-1207-5p	CLIP-seq
MIRT2127422	hsa-miR-1208	CLIP-seq
MIRT2433925	hsa-miR-1228	CLIP-seq
MIRT2127423	hsa-miR-1269	CLIP-seq
MIRT2127424	hsa-miR-1269b	CLIP-seq
MIRT2433926	hsa-miR-1273e	CLIP-seq
MIRT2433927	hsa-miR-1275	CLIP-seq
MIRT2127425	hsa-miR-1279	CLIP-seq
MIRT1425183	hsa-miR-128	CLIP-seq
MIRT1554776	hsa-miR-1286	CLIP-seq
MIRT2127426	hsa-miR-1288	CLIP-seq
MIRT2433928	hsa-miR-1305	CLIP-seq
MIRT1554780	hsa-miR-1343	CLIP-seq
MIRT2433929	hsa-miR-142-5p	CLIP-seq
MIRT2127427	hsa-miR-147	CLIP-seq
MIRT2642573	hsa-miR-18a	CLIP-seq
MIRT2642574	hsa-miR-18b	CLIP-seq
MIRT2127428	hsa-miR-1909	CLIP-seq
MIRT2642575	hsa-miR-191	CLIP-seq
MIRT1554782	hsa-miR-1913	CLIP-seq
MIRT2127429	hsa-miR-200b	CLIP-seq
MIRT2127430	hsa-miR-200c	CLIP-seq
MIRT1554783	hsa-miR-2052	CLIP-seq
MIRT2433931	hsa-miR-219-1-3p	CLIP-seq
MIRT1554787	hsa-miR-3065-3p	CLIP-seq
MIRT2433934	hsa-miR-3065-5p	CLIP-seq
MIRT2433935	hsa-miR-30a	CLIP-seq
MIRT2433936	hsa-miR-30b	CLIP-seq
MIRT2433937	hsa-miR-30c	CLIP-seq
MIRT2433938	hsa-miR-30d	CLIP-seq
MIRT2433939	hsa-miR-30e	CLIP-seq
MIRT1425190	hsa-miR-3119	CLIP-seq
MIRT1554788	hsa-miR-3120-3p	CLIP-seq
MIRT2642576	hsa-miR-3133	CLIP-seq
MIRT2127433	hsa-miR-3151	CLIP-seq
MIRT1425192	hsa-miR-3156-5p	CLIP-seq
MIRT1554791	hsa-miR-3157-3p	CLIP-seq
MIRT2433941	hsa-miR-3170	CLIP-seq
MIRT1425196	hsa-miR-323b-3p	CLIP-seq
MIRT1554794	hsa-miR-324-3p	CLIP-seq
MIRT2433942	hsa-miR-330-3p	CLIP-seq
MIRT2127439	hsa-miR-338-3p	CLIP-seq
MIRT2433943	hsa-miR-340	CLIP-seq
MIRT1554795	hsa-miR-346	CLIP-seq
MIRT2433945	hsa-miR-3545-3p	CLIP-seq
MIRT1425197	hsa-miR-3611	CLIP-seq
MIRT1425199	hsa-miR-361-3p	CLIP-seq
MIRT2433946	hsa-miR-3614-5p	CLIP-seq
MIRT2642577	hsa-miR-3622b-5p	CLIP-seq
MIRT1554797	hsa-miR-3647-3p	CLIP-seq
MIRT2642578	hsa-miR-3671	CLIP-seq
MIRT1554800	hsa-miR-3690	CLIP-seq
MIRT2642579	hsa-miR-3691-5p	CLIP-seq
MIRT2127443	hsa-miR-374c	CLIP-seq
MIRT2642580	hsa-miR-3911	CLIP-seq
MIRT2433950	hsa-miR-3913-3p	CLIP-seq
MIRT2433951	hsa-miR-3919	CLIP-seq
MIRT2433952	hsa-miR-3942-3p	CLIP-seq
MIRT2642581	hsa-miR-3945	CLIP-seq
MIRT1425205	hsa-miR-421	CLIP-seq
MIRT2433953	hsa-miR-425	CLIP-seq
MIRT1425206	hsa-miR-4252	CLIP-seq
MIRT2642582	hsa-miR-4253	CLIP-seq
MIRT1554801	hsa-miR-4254	CLIP-seq
MIRT2433955	hsa-miR-4260	CLIP-seq
MIRT1425207	hsa-miR-4261	CLIP-seq
MIRT2642583	hsa-miR-4281	CLIP-seq
MIRT2433956	hsa-miR-4294	CLIP-seq
MIRT2433958	hsa-miR-4327	CLIP-seq
MIRT2127447	hsa-miR-4330	CLIP-seq
MIRT1554806	hsa-miR-4422	CLIP-seq
MIRT1425215	hsa-miR-4427	CLIP-seq
MIRT1425217	hsa-miR-4433	CLIP-seq
MIRT1425218	hsa-miR-4434	CLIP-seq
MIRT1425221	hsa-miR-4438	CLIP-seq
MIRT2642584	hsa-miR-4449	CLIP-seq
MIRT2433961	hsa-miR-4459	CLIP-seq
MIRT2433962	hsa-miR-4484	CLIP-seq
MIRT2642585	hsa-miR-4488	CLIP-seq
MIRT2127451	hsa-miR-4494	CLIP-seq
MIRT2433964	hsa-miR-4495	CLIP-seq
MIRT1425226	hsa-miR-450b-5p	CLIP-seq
MIRT2127452	hsa-miR-4515	CLIP-seq
MIRT1425227	hsa-miR-4516	CLIP-seq
MIRT2127453	hsa-miR-4530	CLIP-seq
MIRT2642586	hsa-miR-4531	CLIP-seq
MIRT2433967	hsa-miR-4665-5p	CLIP-seq
MIRT2395810	hsa-miR-4668-3p	CLIP-seq
MIRT1554809	hsa-miR-4678	CLIP-seq
MIRT2642587	hsa-miR-4697-5p	CLIP-seq
MIRT1425233	hsa-miR-4709-5p	CLIP-seq
MIRT2433970	hsa-miR-4711-5p	CLIP-seq
MIRT1425234	hsa-miR-4715-3p	CLIP-seq
MIRT2127459	hsa-miR-4717-3p	CLIP-seq
MIRT2349232	hsa-miR-4717-5p	CLIP-seq
MIRT1554812	hsa-miR-4722-5p	CLIP-seq
MIRT2642588	hsa-miR-4735-3p	CLIP-seq
MIRT2127460	hsa-miR-4740-5p	CLIP-seq
MIRT2642589	hsa-miR-4752	CLIP-seq
MIRT2433972	hsa-miR-4753-5p	CLIP-seq
MIRT2433973	hsa-miR-4756-3p	CLIP-seq
MIRT2127462	hsa-miR-4763-3p	CLIP-seq
MIRT2433974	hsa-miR-4768-3p	CLIP-seq
MIRT1425238	hsa-miR-4773	CLIP-seq
MIRT1554818	hsa-miR-4778-3p	CLIP-seq
MIRT2642590	hsa-miR-4783-3p	CLIP-seq
MIRT2127463	hsa-miR-4802-3p	CLIP-seq
MIRT755860	hsa-miR-483-5p	CLIP-seq
MIRT2127464	hsa-miR-486-3p	CLIP-seq
MIRT2433977	hsa-miR-489	CLIP-seq
MIRT1554820	hsa-miR-490-3p	CLIP-seq
MIRT1425239	hsa-miR-493	CLIP-seq
MIRT2127466	hsa-miR-499a-5p	CLIP-seq
MIRT2433979	hsa-miR-501-5p	CLIP-seq
MIRT2349233	hsa-miR-505	CLIP-seq
MIRT1554821	hsa-miR-516a-3p	CLIP-seq
MIRT2433981	hsa-miR-520d-5p	CLIP-seq
MIRT2433982	hsa-miR-524-5p	CLIP-seq
MIRT2433983	hsa-miR-541	CLIP-seq
MIRT2127471	hsa-miR-544	CLIP-seq
MIRT1425241	hsa-miR-548al	CLIP-seq
MIRT2433984	hsa-miR-548an	CLIP-seq
MIRT2693196	hsa-miR-548b-3p	CLIP-seq
MIRT2395813	hsa-miR-548c-3p	CLIP-seq
MIRT1557191	hsa-miR-552	CLIP-seq
MIRT2127472	hsa-miR-570	CLIP-seq
MIRT2433987	hsa-miR-571	CLIP-seq
MIRT2127473	hsa-miR-581	CLIP-seq
MIRT2642591	hsa-miR-589	CLIP-seq
MIRT2433989	hsa-miR-606	CLIP-seq
MIRT1554823	hsa-miR-622	CLIP-seq
MIRT2642592	hsa-miR-628-5p	CLIP-seq
MIRT2642593	hsa-miR-644	CLIP-seq
MIRT1554826	hsa-miR-649	CLIP-seq
MIRT2433991	hsa-miR-654-5p	CLIP-seq
MIRT2127476	hsa-miR-655	CLIP-seq
MIRT1554827	hsa-miR-671-5p	CLIP-seq
MIRT1554829	hsa-miR-764	CLIP-seq
MIRT2441130	hsa-miR-767-3p	CLIP-seq
MIRT2433993	hsa-miR-885-5p	CLIP-seq
MIRT2433994	hsa-miR-888	CLIP-seq
MIRT2433997	hsa-miR-924	CLIP-seq
MIRT1554830	hsa-miR-941	CLIP-seq

Show/Hide all (8)

Transcription factor	Regulation	Reference
ETV4	Unknown	8810321
HIF1A	Activation	17332917
JUN	Unknown	8810321
NR4A1	Activation	22551568
PTTG1	Repression	19351864
SP1	Unknown	10764764
SP3	Unknown	10764764
TFAP2A	Unknown	8810321

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002020	Function	Protease binding	IPI	9573338
GO:0004857	Function	Enzyme inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	12032297, 24112707, 28514442, 32296183, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0008191	Function	Metalloendopeptidase inhibitor activity	IBA
GO:0008191	Function	Metalloendopeptidase inhibitor activity	IEA
GO:0008191	Function	Metalloendopeptidase inhibitor activity	TAS	8810321
GO:0008270	Function	Zinc ion binding	IDA	24073280
GO:0009725	Process	Response to hormone	IBA
GO:0030414	Function	Peptidase inhibitor activity	IDA	9573338
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0031012	Component	Extracellular matrix	HDA	23979707
GO:0031012	Component	Extracellular matrix	IBA
GO:0034097	Process	Response to cytokine	IBA
GO:0034774	Component	Secretory granule lumen	IEA
GO:0035580	Component	Specific granule lumen	TAS
GO:0046872	Function	Metal ion binding	IEA
GO:0051045	Process	Negative regulation of membrane protein ectodomain proteolysis	IBA
GO:0140678	Function	Molecular function inhibitor activity	IMP	8476862
GO:1904724	Component	Tertiary granule lumen	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:1905049	Process	Negative regulation of metallopeptidase activity	IDA	9573338

MIM	HGNC	e!Ensembl
188825	11821	ENSG00000035862

P16035

Protein name

Metalloproteinase inhibitor 2 (CSC-21K) (Tissue inhibitor of metalloproteinases 2) (TIMP-2)

Protein function

Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19.

PDB

1BR9 , 1GXD , 2TMP , 4ILW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00965	TIMP	25 → 203	Tissue inhibitor of metalloproteinase	Domain

Sequence

MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGND
IYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDG
KMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTE
KNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Sequence length

220

Interactions

View interactions

	Reactome
			Activation of Matrix Metalloproteinases Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (22)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CALCINOSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS, EXTRAHEPATIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUPUYTREN CONTRACTURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOYAMOYA DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCCUPATIONAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PLEURAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TIMP2-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (437)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acne	Acne	BEFREE	31032338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	31032338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	LHGDN	17706812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	23793312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	23472970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	17350093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10995877, 21337552, 22292754, 8269281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22735808, 31002360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	24344400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	26071077, 8269281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	31392726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17350093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	23536957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	17448043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolar Soft Part Sarcoma	Alveolar Sarcoma	BEFREE	21552147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	18588710, 19709349, 19895658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	18588710, 23303021	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	12689599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	21228746, 23038618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	9359522	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	10372551, 29687775, 7674473	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	14522424	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angiofibroma	Angiofibroma	BEFREE	17950779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	17348445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31836008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	10372551, 14522424, 24534323, 29687775	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	24534323	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	10372551, 14522424, 15530910, 17899257, 20615646, 24534323, 29687775, 9588507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic valve disease	Pubtator	34148301	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	33129260	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	14522424	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	10400663, 21715326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	12379519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	28012239	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	34691360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16207317	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	11824946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20683101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	20683101, 24993912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	8943093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	18194448, 20138860, 22001292, 27386883, 28901395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	22001292, 35998199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	33129260	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	11756180, 30132572, 31392726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Becker Muscular Dystrophy	Becker Muscular Dystrophy	BEFREE	29682908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	22428754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	10995877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	22555040, 28471417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	27339495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	12133547, 14654538, 27631965, 28980922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	14654538, 17374529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	30548095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	36720443	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	16098049	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	10830727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	1399148, 14604886, 15050733, 15546163, 16776850, 16807982, 17295676, 18386173, 19144199, 19286653, 19431211, 20571065, 22995648, 25656607, 27504971 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16776850, 17613170, 18474097, 18507821, 19431211, 20412339, 20571065, 22995648, 25377085, 25656607, 27504971, 27756325, 30833639, 31088428, 8391548	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16796815, 18386173, 34678879	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	LHGDN	14973177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	28103583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	28103583	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	23151010	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	17325663, 22438955, 31383784	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	11551917	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	1323219, 14654538, 14712492, 18980971, 26808125, 8302724, 8391548, 9815852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	8391548	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	16807982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	16807982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	24344400, 29060924	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	11242804, 25472720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	16807982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	12133547, 14654538, 27631965, 28980922, 30548095, 7591285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	31110546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23371049, 29113325, 29312740, 29505725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	20028387, 30485902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	18630474	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10454537, 11551917, 23281640, 26191221, 29103203	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	12669237, 18092010, 20109015, 23264224, 8601735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	8391548, 8601735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	24344400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11597382, 21115652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	27890770, 31263835	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	20598922	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	31263835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	30569164, 31263835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	27412873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	26539028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	26539028, 37694725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	28487049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	26551785	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	19844095, 25476155, 29435135		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	10780674, 11156216, 14712492, 28731196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	10366463, 10780674, 11156216, 14712492, 17167534, 28186971, 28731196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chagas Disease	Chagas disease	Pubtator	35372112	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	17350093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis, Extrahepatic	Cholestasis	CTD_human_DG	28789951		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholesteatoma	Cholesteatoma	Pubtator	36837507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	10473866	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	11469503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	16731799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	22302011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29915813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28978315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	11757622, 15672858, 15691234, 16919984, 20683101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	15691353, 27363729, 28492359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic venous insufficiency	Venous Insufficiency	BEFREE	28662285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	23563628, 28487049, 30643808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	22730240, 24589636, 24799419, 27876897	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	21462296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	22730240, 24799419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	34183667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21261731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	12184536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10485622, 1323219, 19383344, 21261731, 23661436, 24415879, 26808125, 29763380, 30988064, 31293204, 8895669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10496354, 10901373, 15918187, 16101153, 17649785, 19383344, 21229878, 23661436, 24395652, 24415879, 26363785, 30988064, 31293204, 9310250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15628723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	24415879	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	27173256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Dysplasia Of The Hip	Developmental dysplasia of the hip	BEFREE	27173256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	31793232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29915813, 29930267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16596214, 23281640, 25571919, 26191221, 29103203, 31768131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28137415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28137415		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	28137415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	24934367	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing's symphalangism	Proximal symphalangism	Pubtator	18630474	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	17032449, 19765281, 28139355, 28482921, 28662337, 8655631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	28487203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	17697439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	30412498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	22079283	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	26856768, 27098106, 27434116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	26133107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	16778129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	20617897	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	16778129, 22171077, 27363729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	16778129, 22171077	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33446687, 37446346	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30396876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	9447953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	16728425, 9447953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	16728425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diverticular Diseases	Diverticular Diseases	GWASCAT_DG	30177863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	16807982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren Contracture	GWASCAT_DG	21732829		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dupuytren`s Disease	Dupuytren Contracture	GWASDB_DG	21732829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectrodactyly	Ectrodactyly	Pubtator	31275061	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectropion	Ectropion	BEFREE	31704874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ehlers-Danlos Syndrome	Ehlers-Danlos Syndrome	BEFREE	12878945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	18723334, 23734748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocarditis	Endocarditis	BEFREE	11400152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	19758569, 23205572, 24344400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	25495249	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	11920503, 12372458, 16407419, 17009991, 24344400, 28871006, 29264761	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	10027627, 12372458, 18177649, 22985025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	12372458, 18177649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	12372458	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	18177649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	GWASCAT_DG	25017104		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epithelioma	Epithelioma	BEFREE	10995877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	26202395, 28510611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	23264224, 28510611	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28510611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	22685266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	16214327, 16309669, 18495463, 28186971, 28659595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	11925608, 23563628, 27821159, 30019784, 31638220, 8001673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular cyst	Follicular Cyst	BEFREE	27993358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	17697439	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	22621753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	12439941, 15832413, 24863943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	21337552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	37958643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	17502363, 34204585	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	25312247, 31298305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	26539028	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	26539028, 31298305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11235952, 14631378, 16622457, 17048097, 19187648, 27633774, 28927111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	14631378, 20448453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11235952, 14631378, 16622457, 19187648, 27633774, 28927111		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	10389763, 15363547, 29959056, 30272348, 31545229, 7898625		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	20448453, 25731730, 9721888	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves Disease	BEFREE	29521049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	16275157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29915813, 29930267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	37909603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	11146452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematoma	Hematoma	Pubtator	26551785	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	23151010	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	26551785	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	40300315	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatorenal Syndrome	Hepatorenal Syndrome	BEFREE	31389249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	10496354	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	10697802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	24415879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11756180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	11756180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	14962256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	LHGDN	12614934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	29459817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28110412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	31377002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	27412873	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	28390988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31301303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	LHGDN	15056834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	36269774	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	10971173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	10956632, 18723334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	30347407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	22735808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	21343147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	10861266, 30011062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	26133107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	32626912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	10372551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	LHGDN	14605322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	16807982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	19844095, 30240841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	28012239, 31781639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	8156782, 9543631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28682920, 29883532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	40025594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	29915813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	24675717, 27634440, 28003188, 28011057, 28085896, 28107490, 28255639, 28295429, 28340605, 28382566, 28537976, 28558754, 28682920, 28750409, 28755073 View all (29 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	22302011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	26191221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	16265652, 31110546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	19815660, 28390988, 30926902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	22685266, 23814095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15870703, 23472970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10233411, 27039800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10353746, 15870703, 20138666, 27039800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	17342343, 27853937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10089944, 10374394, 11242804, 12768188, 15870919, 22262409, 9075667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17564313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	11925608, 15591520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	23563628, 28487049, 30643808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	12439941	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	24068394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	9075667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	19596921, 29113325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	19596921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19116456	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22593690	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23474755	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	33093251	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	10901373, 16424893	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	16237750, 16796815, 24415879, 24800696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	17009991	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15870703, 18954439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	18954439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	15870703, 22020421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	22020421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lynch Syndrome	Lynch Syndrome	BEFREE	24415879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	10830727, 11235952, 15363547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	16275157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	1399148, 14604886, 15050733, 15546163, 16776850, 16807982, 18386173, 19144199, 19431211, 20571065, 22995648, 25656607, 27504971, 27775427, 29085477, 31088428, 31452731, 31621840, 9815852 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	19758569, 23205572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28510611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	22621753, 25405519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	23281640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	31110546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	9075667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23371049, 29113325, 29312740, 29505725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	17342343, 27853937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11597382, 21115652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11773977, 30719232, 7635566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11477554, 14598888, 17325663, 17847032, 22374248, 22555040, 25310386, 27191265, 9174126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16940985, 17236757, 17954022, 24440352, 29220395, 29941993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	14654538, 27631965, 28980922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	30548095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10669955, 10830727, 12704680, 14654538, 14712492, 14716815, 15870703, 17342343, 21775132, 22374248, 22735808, 23371049, 24782132, 25136829, 26148591 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	10780674, 11156216, 14712492, 28731196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21261731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12602913, 14744773, 17613170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15546163, 28765266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	16820601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	17348445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10188875	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10360651, 10409657, 2380196, 25839957, 2793861, 32934956, 7534227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10555745, 2380196, 24335752		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	11606052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	32934956	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	12527924, 25259564, 29753168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	26856768, 27098106, 27434116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29912573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	23043936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	23043936	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	27853937	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	BEFREE	16723886, 23769926, 25280484		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Moyamoya Disease	Moyamoya Disease	LHGDN	16723886		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Moyamoya Disease	Moyamoya disease	Pubtator	25280484	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Moyamoya disease 1	Moyamoya disease	BEFREE	16723886, 23769926, 25280484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	17643768, 20534943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	18472160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	26268417, 26464662, 30626425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	26268417, 26464662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10330301, 10496173, 12458052, 27174941, 31741027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	16042227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	27174941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	29682908	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	15616792, 17662584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	LHGDN	15616792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Emery-Dreifuss	Emery-Dreifuss Muscular Dystrophy	BEFREE	25563468		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10353746, 27039800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	27039800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10353746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	24358288		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	25153995	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	28137415, 30763602, 31182988		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	37119187	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopia	Myopia	BEFREE	21421877, 28384717, 30244069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	22171077	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	22171077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	26823777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	18092010, 29693120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	29693120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	25263345	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10089944, 10365151, 10695623, 11146452, 11172604, 11235952, 11242804, 11268284, 11355270, 11431737, 11437402, 11756180, 11988310, 12034400, 12220955 View all (59 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephronophthisis	Nephronophthisis	BEFREE	19381676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10726683, 12749850, 19883732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	28487203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	19883732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	LHGDN	16772717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28946547, 29912573, 30134384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	LHGDN	18265895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19596921, 22735808, 26278569, 28392366, 28392461, 29312740, 29565489, 30024604, 30272338, 31061410, 31545237, 31632575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	16807982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	17217211	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Orofacial Cleft 1	Orofacial cleft	Pubtator	22730240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	27901480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	27901480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta Type IV	Osteogenesis imperfecta	Pubtator	2793861	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	18469019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	36720443	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	16327977, 29434787, 30765222, 31773678, 8906876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	30481751, 31383784, 31773678, 33725949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	11597382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	20385381	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	30583769		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10995877, 21115652		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18424416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	15557756, 20607860, 21115652, 22511598, 31703725, 33023532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11773977, 30719232, 7635566, 9349239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24998559	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	11889077	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma Choroid Plexus	Choroid plexus papilloma	Pubtator	20385381	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	12689599, 19883732, 26844501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	26844501	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	37446346	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	24343133, 34973089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	28656271	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	17448043, 8410600		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	31579944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	31392726		★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	29541006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural Diseases	Pleural Diseases	CTD_human_DG	24142982		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pleural Diseases	Pleural diseases	Pubtator	24142982	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PNEUMOTHORAX, PRIMARY SPONTANEOUS	Pneumothorax	BEFREE	25300296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	39796177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	30412498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11477554, 14598888, 17325663, 17847032, 22374248, 22555040, 25310386, 27191265, 9174126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	22555040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	17325663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17325663, 18329693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17325663	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22272343, 22555040, 31115550, 37463569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	17652725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	20808962	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	11757622, 15672858, 20683101, 26126526, 30781876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	19085563	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21861887	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	23734748, 9759652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	21261731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent depressive disorder	Mental Depression	BEFREE	27434116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11551917, 16596214, 23281640, 25571919, 26191221, 29103203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	17572184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	9385361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy of prematurity	Pubtator	28103583	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy of prematurity	Pubtator	36430677, 37894989	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11248661, 19765281, 9923652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	25412957	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	19847138, 21959615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	21959615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Alveolar Soft Part	Sarcoma	Pubtator	19146682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	37909603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	29385606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	9540985	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis	Scoliosis	Pubtator	31119800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28884304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe myopia	Myopia	BEFREE	21421877, 28900109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Simple renal cyst	Renal cyst	BEFREE	19381676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sinus Thrombosis, Intracranial	Sinus Thrombosis, Intracranial	BEFREE	29431912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	16142742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	LHGDN	18042068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	8601735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	8601735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	31486131, 31741027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12479097, 16142392, 16424893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17342343, 22292754, 8601735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	16097450, 16424893, 19241124, 30143678, 32495877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	16275157, 18846112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	10971173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16237750, 16940985, 17236757, 17954022, 20718757, 24440352, 29220395, 29941993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	16237750, 16940985, 24440352, 24800696, 29220395, 29941993, 9008095, 9681807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17954022, 18498066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	17493602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	9373715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	28888475, 29620182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	29521049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	36156766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	22820140	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	9545106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	22820140	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	12133547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31621840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34678879	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	31183875	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tumoral calcinosis	Tumoral Calcinosis	CTD_human_DG	24142982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	22730240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	20408180, 27631965, 31401412	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Incontinence Stress	Stress urinary incontinence	Pubtator	33836021	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	16619570, 37932662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	15816637, 16619570, 25803820, 28849054, 32669083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	22685266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	18300240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	26848019	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicose Veins	Varicose veins	Pubtator	12844106, 20598922, 24505358, 29267209	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	21195432, 26130791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	23151010	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	20103936	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	37891465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	28407719	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitelliform Macular Dystrophy	Vitelliform Macular Dystrophy	BEFREE	29682908		★★★★★ ★☆☆☆☆ Found in Text Mining only

TIMP2 (TIMP metallopeptidase inhibitor 2)