Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7074
Gene name	TIAM Rac1 associated GEF 1
Gene symbol	TIAM1
Synonyms (NCBI Gene)	NEDLDSTIAM-1
Chromosome	21
Chromosome location	21q22.11
Summary	This gene encodes a RAC1-specific guanine nucleotide exchange factor (GEF). GEFs mediate the exchange of guanosine diphosphate (GDP) for guanosine triphosphate (GTP). The binding of GTP induces a conformational change in RAC1 that allows downstream effect

118

Show/Hide all (118)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005565	hsa-miR-21-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCR	20826792
MIRT005565	hsa-miR-21-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCR	20826792
MIRT005565	hsa-miR-21-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCR	20826792
MIRT005566	hsa-miR-31-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCR	20826792
MIRT005566	hsa-miR-31-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCR	20826792
MIRT005565	hsa-miR-21-5p	Luciferase reporter assay	23442323
MIRT018498	hsa-miR-335-5p	Microarray	18185580
MIRT052155	hsa-let-7b-5p	CLASH	23622248
MIRT046873	hsa-miR-221-3p	CLASH	23622248
MIRT040238	hsa-miR-615-3p	CLASH	23622248
MIRT039107	hsa-miR-769-3p	CLASH	23622248
MIRT038766	hsa-miR-93-3p	CLASH	23622248
MIRT037502	hsa-miR-744-5p	CLASH	23622248
MIRT053593	hsa-miR-10b-5p	Luciferase reporter assayqRT-PCRWestern blot	24481854
MIRT054278	hsa-miR-329-3p	Luciferase reporter assayqRT-PCRWestern blot	25654811
MIRT054278	hsa-miR-329-3p	Luciferase reporter assayqRT-PCRWestern blot	25654811
MIRT054429	hsa-miR-141-3p	Luciferase reporter assayqRT-PCRWestern blot	24551096
MIRT054429	hsa-miR-141-3p	Luciferase reporter assayqRT-PCRWestern blot	24551096
MIRT437579	hsa-miR-10a-5p	MicroarrayqRT-PCR	22815788
MIRT005565	hsa-miR-21-5p	MicroarrayqRT-PCR	22815788
MIRT437738	hsa-miR-342-3p	MicroarrayqRT-PCR	22815788
MIRT438887	hsa-miR-22-3p	Luciferase reporter assayWestern blot	23440286
MIRT438431	hsa-miR-29c-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23142282
MIRT438887	hsa-miR-22-3p	Luciferase reporter assayWestern blot	23440286
MIRT438431	hsa-miR-29c-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23142282
MIRT1424504	hsa-miR-1207-3p	CLIP-seq
MIRT1424505	hsa-miR-1245b-3p	CLIP-seq
MIRT1424506	hsa-miR-1248	CLIP-seq
MIRT1424507	hsa-miR-1262	CLIP-seq
MIRT1424508	hsa-miR-1323	CLIP-seq
MIRT1424509	hsa-miR-1537	CLIP-seq
MIRT1424510	hsa-miR-183	CLIP-seq
MIRT1424511	hsa-miR-19a	CLIP-seq
MIRT1424512	hsa-miR-19b	CLIP-seq
MIRT1424513	hsa-miR-21	CLIP-seq
MIRT1424514	hsa-miR-22	CLIP-seq
MIRT1424515	hsa-miR-29a	CLIP-seq
MIRT1424516	hsa-miR-29b	CLIP-seq
MIRT1424517	hsa-miR-29c	CLIP-seq
MIRT1424518	hsa-miR-3117-3p	CLIP-seq
MIRT1424519	hsa-miR-3122	CLIP-seq
MIRT1424520	hsa-miR-3134	CLIP-seq
MIRT1424521	hsa-miR-3138	CLIP-seq
MIRT1424522	hsa-miR-3153	CLIP-seq
MIRT1424523	hsa-miR-3169	CLIP-seq
MIRT1424524	hsa-miR-335	CLIP-seq
MIRT1424525	hsa-miR-3647-3p	CLIP-seq
MIRT1424526	hsa-miR-3655	CLIP-seq
MIRT1424527	hsa-miR-3659	CLIP-seq
MIRT1424528	hsa-miR-3662	CLIP-seq
MIRT1424529	hsa-miR-3667-5p	CLIP-seq
MIRT1424530	hsa-miR-3691-3p	CLIP-seq
MIRT1424531	hsa-miR-3913-5p	CLIP-seq
MIRT1424532	hsa-miR-3924	CLIP-seq
MIRT1424533	hsa-miR-3936	CLIP-seq
MIRT1424534	hsa-miR-3942-3p	CLIP-seq
MIRT1424535	hsa-miR-4259	CLIP-seq
MIRT1424536	hsa-miR-4289	CLIP-seq
MIRT1424537	hsa-miR-4320	CLIP-seq
MIRT1424538	hsa-miR-4325	CLIP-seq
MIRT1424539	hsa-miR-4476	CLIP-seq
MIRT1424540	hsa-miR-4502	CLIP-seq
MIRT1424541	hsa-miR-4504	CLIP-seq
MIRT1424542	hsa-miR-450b-3p	CLIP-seq
MIRT1424543	hsa-miR-4662a-3p	CLIP-seq
MIRT1424544	hsa-miR-4668-5p	CLIP-seq
MIRT1424545	hsa-miR-4676-5p	CLIP-seq
MIRT1424546	hsa-miR-4684-3p	CLIP-seq
MIRT1424547	hsa-miR-4696	CLIP-seq
MIRT1424548	hsa-miR-4701-3p	CLIP-seq
MIRT1424549	hsa-miR-4759	CLIP-seq
MIRT1424550	hsa-miR-4762-3p	CLIP-seq
MIRT1424551	hsa-miR-4764-5p	CLIP-seq
MIRT1424552	hsa-miR-4795-5p	CLIP-seq
MIRT1424553	hsa-miR-4797-5p	CLIP-seq
MIRT1424554	hsa-miR-4802-3p	CLIP-seq
MIRT1424555	hsa-miR-499a-5p	CLIP-seq
MIRT1424556	hsa-miR-515-5p	CLIP-seq
MIRT1424557	hsa-miR-542-3p	CLIP-seq
MIRT1424558	hsa-miR-548aa	CLIP-seq
MIRT1424559	hsa-miR-548o	CLIP-seq
MIRT1424560	hsa-miR-575	CLIP-seq
MIRT1424561	hsa-miR-578	CLIP-seq
MIRT1424562	hsa-miR-590-5p	CLIP-seq
MIRT1424563	hsa-miR-617	CLIP-seq
MIRT1424564	hsa-miR-653	CLIP-seq
MIRT1424565	hsa-miR-758	CLIP-seq
MIRT1424513	hsa-miR-21	CLIP-seq
MIRT1424525	hsa-miR-3647-3p	CLIP-seq
MIRT1424528	hsa-miR-3662	CLIP-seq
MIRT1424538	hsa-miR-4325	CLIP-seq
MIRT2127226	hsa-miR-4642	CLIP-seq
MIRT1424545	hsa-miR-4676-5p	CLIP-seq
MIRT1424546	hsa-miR-4684-3p	CLIP-seq
MIRT2127227	hsa-miR-514	CLIP-seq
MIRT2127228	hsa-miR-514b-3p	CLIP-seq
MIRT1424560	hsa-miR-575	CLIP-seq
MIRT1424562	hsa-miR-590-5p	CLIP-seq
MIRT1424564	hsa-miR-653	CLIP-seq
MIRT1424510	hsa-miR-183	CLIP-seq
MIRT2349055	hsa-miR-2467-3p	CLIP-seq
MIRT1424515	hsa-miR-29a	CLIP-seq
MIRT1424516	hsa-miR-29b	CLIP-seq
MIRT1424517	hsa-miR-29c	CLIP-seq
MIRT1424524	hsa-miR-335	CLIP-seq
MIRT2349056	hsa-miR-3607-3p	CLIP-seq
MIRT1424526	hsa-miR-3655	CLIP-seq
MIRT1424527	hsa-miR-3659	CLIP-seq
MIRT1424533	hsa-miR-3936	CLIP-seq
MIRT1424534	hsa-miR-3942-3p	CLIP-seq
MIRT2349057	hsa-miR-4514	CLIP-seq
MIRT2349058	hsa-miR-4690-5p	CLIP-seq
MIRT2349059	hsa-miR-4692	CLIP-seq
MIRT1424555	hsa-miR-499a-5p	CLIP-seq
MIRT1424556	hsa-miR-515-5p	CLIP-seq
MIRT1424561	hsa-miR-578	CLIP-seq
MIRT1424563	hsa-miR-617	CLIP-seq
MIRT1424556	hsa-miR-515-5p	CLIP-seq

Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	EXP	15721239
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IDA	23109420
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IMP	20361982, 25684205
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	TAS	10835422
GO:0005515	Function	Protein binding	IPI	17440041, 21763699, 23109420, 23395182, 25684205, 32707033, 35914814
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	23109420
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	23109420
GO:0005886	Component	Plasma membrane	IEA
GO:0005911	Component	Cell-cell junction	IDA	20332120
GO:0007160	Process	Cell-matrix adhesion	IMP	20361982
GO:0007165	Process	Signal transduction	IEA
GO:0007264	Process	Small GTPase-mediated signal transduction	IBA
GO:0007264	Process	Small GTPase-mediated signal transduction	IDA	23109420
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	25032858
GO:0008289	Function	Lipid binding	IEA
GO:0010717	Process	Regulation of epithelial to mesenchymal transition	IDA	20826792
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	NAS	17086355
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IMP	20361982
GO:0016601	Process	Rac protein signal transduction	IDA	25032858
GO:0016601	Process	Rac protein signal transduction	IMP	20361982
GO:0019900	Function	Kinase binding	IPI	23109420
GO:0030335	Process	Positive regulation of cell migration	IDA	25032858
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035567	Process	Non-canonical Wnt signaling pathway	IDA	23109420
GO:0035567	Process	Non-canonical Wnt signaling pathway	ISS
GO:0044291	Component	Cell-cell contact zone	IDA	20361982
GO:0045202	Component	Synapse	IBA
GO:0048013	Process	Ephrin receptor signaling pathway	TAS
GO:0050772	Process	Positive regulation of axonogenesis	IBA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	NAS	24431302
GO:0065003	Process	Protein-containing complex assembly	IDA	23109420
GO:0070161	Component	Anchoring junction	IEA
GO:1904338	Process	Regulation of dopaminergic neuron differentiation	ISS

MIM	HGNC	e!Ensembl
600687	11805	ENSG00000156299

Q13009

Protein name

Rho guanine nucleotide exchange factor TIAM1 (T-lymphoma invasion and metastasis-inducing protein 1) (TIAM-1)

Protein function

Guanyl-nucleotide exchange factor that activates RHO-like proteins and connects extracellular signals to cytoskeletal activities. Activates RAC1, CDC42, and to a lesser extent RHOA and their downstream signaling to regulate processes like cell a

PDB

2D8I , 3KZD , 3KZE , 4GVC , 4GVD , 4K2O , 4K2P , 4NXP , 4NXQ , 4NXR

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00169	PH	440 → 547	PH domain	Domain
PF18385	Tiam_CC_Ex	572 → 669	T-lymphoma invasion and metastasis CC-Ex domain	Domain
PF02196	RBD	766 → 839	Raf-like Ras-binding domain	Domain
PF00595	PDZ	845 → 925	PDZ domain	Domain
PF00621	RhoGEF	1044 → 1232	RhoGEF domain	Domain
PF00169	PH	1263 → 1395	PH domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Found in virtually all analyzed tumor cell lines including B- and T-lymphomas, neuroblastomas, melanomas and carcinomas.

Sequence

MGNAESQHVEHEFYGEKHASLGRKHTSRSLRLSHKTRRTRHASSGKVIHRNSEVSTRSSS
TPSIPQSLAENGLEPFSQDGTLEDFGSPIWVDRVDMGLRPVSYTDSSVTPSVDSSIVLTA
ASVQSMPDTEESRLYGDDATYLAEGGRRQHSYTSNGPTFMETASFKKKRSKSADIWREDS
LEFSLSDLSQEHLTSNEEILGSAEEKDCEEARGMETRASPRQLSTCQRANSLGDLYAQKN
SGVTANGGPGSKFAGYCRNLVSDIPNLANHKMPPAAAEETPPYSNYNTLPCRKSHCLSEG
ATNPQISHSNSMQGRRAKTTQDVNAGEGSEFADSGIEGATTDTDLLSRRSNATNSSYSPT
TGRAFVGSDSGSSSTGDAARQGVYENFRRELEMSTTNSESLEEAGSAHSDEQSSGTLSSP
GQSDILLTAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYESD
GRSGIDHNSIPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWIT
AIHSACATAVARHHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKKTI
LDQIFVWEQNLEQFQMDLFRFRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSVS
SFHALVAARTGETGVRRRTQAMSRSASKRRSRFSSLWGLDTTSKKKQGRPSINQVFGEGT
EAVKKSLEGIFDDIVPDGKREKEVVLPNVHQHNPDCDIWVHEYFTPSWFCLPNNQPALTV
VRPGDTARDTLELICKTHQLDHSAHYLRLKFLIENKMQLYVPQPEEDIYELLYKEIEICP
KVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINN
RAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVELLESPPHRVDGPADLGESPLAFLTS
NPGHSLCSEQGSSAETAPEETEGPDLESSDETDHSSKSTEQVAAFCRSLHEMNPSDQSPS
PQDSTGPQLATMRQLSDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDE
LDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFK
LYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPKQQHSSTLESYLIKPIQRILKYPLLL
RELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVA
DLSMGDLLLHTTVIWLNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRL
SIYEDWDPFRFRHMIPTEALQVRALASADAEANAVCEIVHVKSESEGRPERVFHLCCSSP
ESRKDFLKAVHSILRDKHRRQLLKTESLPSSQQYVPFGGKRLCALKGARPAMSRAVSAPS
KSLGRRRRRLARNRFTIDSDAVSASSPEKESQQPPGGGDTDRWVEEQFDLAQYEEQDDIK
ETDILSDDDEFCESVKGASVDRDLQERLQATSISQRERGRKTLDSHASRMAQLKKQAALS
GINGGLESASEEVIWVRREDFAPSRKLNTEI

Sequence length

1591

Interactions

View interactions

	KEGG		Reactome
	Ras signaling pathway Rap1 signaling pathway cAMP signaling pathway Chemokine signaling pathway Tight junction Regulation of actin cytoskeleton Proteoglycans in cancer		NRAGE signals death through JNK Rho GTPase cycle EPHB-mediated forward signaling EPH-ephrin mediated repulsion of cells G alpha (12/13) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Neurodevelopmental disorder with language delay and seizures	Pathogenic	rs1249016772, rs760187500, rs759037691, rs1319513413	RCV002260889 RCV002260890 RCV002260891 RCV002260892	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (16)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS 1	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHAGAS CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOTOR NEURON DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOUTH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TIAM1-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (105)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	9713998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27588399, 30863182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	GWASDB_DG	20801718		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	GWASCAT_DG	20801718		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	20801718	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	CTD_human_DG	11796754		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	BEFREE	29067109		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	CTD_human_DG	11796754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	CTD_human_DG	11796754		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30100742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	27725632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	14999151, 20444703, 20819206, 26821678, 27562113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11328805, 20444703, 20819206, 35773411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27562113	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	22302986	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	22469921, 25543140, 7731688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	27562113	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24551096, 25739101, 37047360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	27562113	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15295645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35844783	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	20429013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26716504	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular Abnormalities	BEFREE	24362460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29178143		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29452216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	29452216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29452216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	26884821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	26884821	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23440286, 30212824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	17086355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	20826792	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15655826, 17132223, 18675922, 19276682, 25032858, 28347238, 28416184, 29067109, 30890693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15655826, 17086355, 17132223, 17376711, 18675922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15655826, 19276682, 28347238, 34526059	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	17086355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conduction disorder of the heart	Conduction Disorder Of The Heart	BEFREE	22693452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11054665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	24508273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	24508273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	9713998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial medullary thyroid carcinoma	Thyroid cancer	Pubtator	33692755	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29067109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	18592271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	27562113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	25672412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	17352239, 20215110	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	9713998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18972435, 21971868, 22573407, 23442323, 24551096, 25739101, 29739365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18972435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	21971868, 23442323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22524833, 37748077	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	19276682, 22524833, 24661909, 26369827, 26884821	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20429013	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	23422181, 31413590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10512681, 14999151, 17132223, 23422181, 23950931, 8595894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	14999151, 20444703, 20819206, 26821678, 27562113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	CTD_human_DG	27862620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23322732, 30100742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23422181, 23754572, 25654811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	29277502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21469146, 21971868, 23422181, 23950931, 25672412, 26821678, 26884821, 29178143, 29452216, 29920278, 30863182, 31205545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29452216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23440286, 30212824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18592271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	19082465		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23337888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	15340013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	CTD_human_DG	27862620		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Narcolepsy	Narcolepsy	GWASDB_DG	19629137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	23142282, 24912585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12684618, 17086355, 17132223, 18592271, 20819206, 21971868, 22573407, 23322732, 23337888, 24852430, 26884821, 27562113, 27862620, 28685528, 30863182, 30890693, 7731688 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22367537, 28423360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	22367537, 28423360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30722989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	27562113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24136929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25973950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	25973950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32948241	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	16757353, 30100742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	23322732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18472958, 23322732, 24136929, 40303408	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	40392613	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	17003780	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17003780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17003780, 38246227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29067109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11054665, 11551917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	23950931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	23950931	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	18592271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	27862620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	27862620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	21186404, 24852430, 30426564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26369827	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23422181, 23754572, 25654811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18246045, 23534724, 38246227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	18675922, 20819206, 23754572, 26959888, 30100742, 31413590, 31702612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	33692755	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	29277502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27902969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	30504727	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TIAM1 (TIAM Rac1 associated GEF 1)