Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7070
Gene name	Thy-1 cell surface antigen
Gene symbol	THY1
Synonyms (NCBI Gene)	CD90CDw90
Chromosome	11
Chromosome location	11q23.3
Summary	This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins. The encoded protein is involved in cell adhesion and cell communication in numerous cell types, but particularly in cells of the immune and nervous sys

545

Show/Hide all (545)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024103	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT490393	hsa-miR-139-3p	PAR-CLIP	20371350
MIRT490394	hsa-miR-4781-5p	PAR-CLIP	20371350
MIRT490393	hsa-miR-139-3p	PAR-CLIP	20371350
MIRT490392	hsa-miR-1228-5p	PAR-CLIP	20371350
MIRT490394	hsa-miR-4781-5p	PAR-CLIP	20371350
MIRT490393	hsa-miR-139-3p	PAR-CLIP	20371350
MIRT490392	hsa-miR-1228-5p	PAR-CLIP	20371350
MIRT490394	hsa-miR-4781-5p	PAR-CLIP	20371350
MIRT490393	hsa-miR-139-3p	PAR-CLIP	20371350
MIRT490392	hsa-miR-1228-5p	PAR-CLIP	20371350
MIRT490410	hsa-miR-33b-3p	PAR-CLIP	23592263
MIRT490409	hsa-miR-515-3p	PAR-CLIP	23592263
MIRT490408	hsa-miR-519e-3p	PAR-CLIP	23592263
MIRT490407	hsa-miR-4287	PAR-CLIP	23592263
MIRT490406	hsa-miR-4685-3p	PAR-CLIP	23592263
MIRT490404	hsa-miR-6778-3p	PAR-CLIP	23592263
MIRT490405	hsa-miR-6791-3p	PAR-CLIP	23592263
MIRT490403	hsa-miR-6829-3p	PAR-CLIP	23592263
MIRT490402	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT490401	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT490400	hsa-miR-4649-5p	PAR-CLIP	23592263
MIRT490399	hsa-miR-6729-5p	PAR-CLIP	23592263
MIRT490398	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT490397	hsa-miR-6836-3p	PAR-CLIP	23592263
MIRT490395	hsa-miR-4706	PAR-CLIP	23592263
MIRT490396	hsa-miR-519d-3p	PAR-CLIP	23592263
MIRT490394	hsa-miR-4781-5p	PAR-CLIP	23592263
MIRT490393	hsa-miR-139-3p	PAR-CLIP	23592263
MIRT490392	hsa-miR-1228-5p	PAR-CLIP	23592263
MIRT490392	hsa-miR-1228-5p	PAR-CLIP	26701625
MIRT490394	hsa-miR-4781-5p	PAR-CLIP	26701625
MIRT490393	hsa-miR-139-3p	PAR-CLIP	20371350
MIRT490394	hsa-miR-4781-5p	PAR-CLIP	20371350
MIRT490393	hsa-miR-139-3p	PAR-CLIP	20371350
MIRT490392	hsa-miR-1228-5p	PAR-CLIP	20371350
MIRT490394	hsa-miR-4781-5p	PAR-CLIP	20371350
MIRT490393	hsa-miR-139-3p	PAR-CLIP	20371350
MIRT490392	hsa-miR-1228-5p	PAR-CLIP	20371350
MIRT490394	hsa-miR-4781-5p	PAR-CLIP	20371350
MIRT490393	hsa-miR-139-3p	PAR-CLIP	20371350
MIRT490392	hsa-miR-1228-5p	PAR-CLIP	20371350
MIRT490410	hsa-miR-33b-3p	PAR-CLIP	23592263
MIRT490409	hsa-miR-515-3p	PAR-CLIP	23592263
MIRT490408	hsa-miR-519e-3p	PAR-CLIP	23592263
MIRT490407	hsa-miR-4287	PAR-CLIP	23592263
MIRT490406	hsa-miR-4685-3p	PAR-CLIP	23592263
MIRT490404	hsa-miR-6778-3p	PAR-CLIP	23592263
MIRT490405	hsa-miR-6791-3p	PAR-CLIP	23592263
MIRT490403	hsa-miR-6829-3p	PAR-CLIP	23592263
MIRT490402	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT490401	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT490400	hsa-miR-4649-5p	PAR-CLIP	23592263
MIRT490399	hsa-miR-6729-5p	PAR-CLIP	23592263
MIRT490398	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT490397	hsa-miR-6836-3p	PAR-CLIP	23592263
MIRT490395	hsa-miR-4706	PAR-CLIP	23592263
MIRT490396	hsa-miR-519d-3p	PAR-CLIP	23592263
MIRT490394	hsa-miR-4781-5p	PAR-CLIP	23592263
MIRT490393	hsa-miR-139-3p	PAR-CLIP	23592263
MIRT490392	hsa-miR-1228-5p	PAR-CLIP	23592263
MIRT1424294	hsa-miR-1237	CLIP-seq
MIRT1424295	hsa-miR-1248	CLIP-seq
MIRT1424296	hsa-miR-1287	CLIP-seq
MIRT1424297	hsa-miR-1299	CLIP-seq
MIRT1424298	hsa-miR-1302	CLIP-seq
MIRT1424299	hsa-miR-136	CLIP-seq
MIRT1424300	hsa-miR-3122	CLIP-seq
MIRT1424301	hsa-miR-3125	CLIP-seq
MIRT1424302	hsa-miR-3689a-3p	CLIP-seq
MIRT1424303	hsa-miR-3689c	CLIP-seq
MIRT1424304	hsa-miR-3913-5p	CLIP-seq
MIRT1424305	hsa-miR-3916	CLIP-seq
MIRT1424306	hsa-miR-4270	CLIP-seq
MIRT1424307	hsa-miR-4298	CLIP-seq
MIRT1424308	hsa-miR-4300	CLIP-seq
MIRT1424309	hsa-miR-4441	CLIP-seq
MIRT1424310	hsa-miR-4453	CLIP-seq
MIRT1424311	hsa-miR-4493	CLIP-seq
MIRT1424312	hsa-miR-4538	CLIP-seq
MIRT1424313	hsa-miR-4639-3p	CLIP-seq
MIRT1424314	hsa-miR-4717-3p	CLIP-seq
MIRT1424315	hsa-miR-4753-5p	CLIP-seq
MIRT1424316	hsa-miR-515-5p	CLIP-seq
MIRT1424317	hsa-miR-635	CLIP-seq
MIRT1424318	hsa-miR-671-5p	CLIP-seq
MIRT1424319	hsa-miR-765	CLIP-seq
MIRT1424320	hsa-miR-875-3p	CLIP-seq
MIRT1424321	hsa-miR-920	CLIP-seq
MIRT1554765	hsa-miR-3132	CLIP-seq
MIRT2127177	hsa-miR-129-5p	CLIP-seq
MIRT2127178	hsa-miR-3188	CLIP-seq
MIRT2127179	hsa-miR-323-5p	CLIP-seq
MIRT2127180	hsa-miR-323b-5p	CLIP-seq
MIRT2127181	hsa-miR-4251	CLIP-seq
MIRT2127182	hsa-miR-4279	CLIP-seq
MIRT2127183	hsa-miR-4286	CLIP-seq
MIRT2127184	hsa-miR-4290	CLIP-seq
MIRT2127185	hsa-miR-4474-3p	CLIP-seq
MIRT2127186	hsa-miR-4761-5p	CLIP-seq
MIRT2127187	hsa-miR-580	CLIP-seq
MIRT2127188	hsa-miR-615-5p	CLIP-seq
MIRT2127189	hsa-miR-659	CLIP-seq
MIRT2127190	hsa-miR-876-3p	CLIP-seq
MIRT2349030	hsa-miR-1263	CLIP-seq
MIRT2349031	hsa-miR-129-3p	CLIP-seq
MIRT2349032	hsa-miR-193a-5p	CLIP-seq
MIRT2349033	hsa-miR-2110	CLIP-seq
MIRT2349034	hsa-miR-3121-5p	CLIP-seq
MIRT1424301	hsa-miR-3125	CLIP-seq
MIRT2349035	hsa-miR-3150a-3p	CLIP-seq
MIRT2349036	hsa-miR-3175	CLIP-seq
MIRT2349037	hsa-miR-3674	CLIP-seq
MIRT1424305	hsa-miR-3916	CLIP-seq
MIRT1424306	hsa-miR-4270	CLIP-seq
MIRT2349038	hsa-miR-4434	CLIP-seq
MIRT1424309	hsa-miR-4441	CLIP-seq
MIRT2349039	hsa-miR-4516	CLIP-seq
MIRT2349040	hsa-miR-4687-5p	CLIP-seq
MIRT2127188	hsa-miR-615-5p	CLIP-seq
MIRT2349041	hsa-miR-939	CLIP-seq
MIRT2433905	hsa-miR-1273f	CLIP-seq
MIRT2433906	hsa-miR-1294	CLIP-seq
MIRT2433907	hsa-miR-143	CLIP-seq
MIRT2433908	hsa-miR-147b	CLIP-seq
MIRT2433909	hsa-miR-2355-3p	CLIP-seq
MIRT1554765	hsa-miR-3132	CLIP-seq
MIRT2433910	hsa-miR-3180-5p	CLIP-seq
MIRT2127178	hsa-miR-3188	CLIP-seq
MIRT2433911	hsa-miR-320e	CLIP-seq
MIRT2433912	hsa-miR-3909	CLIP-seq
MIRT2433913	hsa-miR-3944-5p	CLIP-seq
MIRT2433914	hsa-miR-4328	CLIP-seq
MIRT2433915	hsa-miR-4646-3p	CLIP-seq
MIRT2433916	hsa-miR-4708-5p	CLIP-seq
MIRT2433917	hsa-miR-4710	CLIP-seq
MIRT2433918	hsa-miR-4770	CLIP-seq
MIRT2433919	hsa-miR-4773	CLIP-seq
MIRT2433920	hsa-miR-520a-5p	CLIP-seq
MIRT2433921	hsa-miR-525-5p	CLIP-seq
MIRT2433922	hsa-miR-548b-3p	CLIP-seq
MIRT2433923	hsa-miR-658	CLIP-seq
MIRT2433924	hsa-miR-676	CLIP-seq
MIRT2441105	hsa-miR-3130-3p	CLIP-seq
MIRT2441106	hsa-miR-3919	CLIP-seq
MIRT2441107	hsa-miR-4661-3p	CLIP-seq
MIRT2441108	hsa-miR-4756-3p	CLIP-seq
MIRT2441109	hsa-miR-4793-3p	CLIP-seq
MIRT2127182	hsa-miR-4279	CLIP-seq
MIRT2127183	hsa-miR-4286	CLIP-seq
MIRT2127186	hsa-miR-4761-5p	CLIP-seq
MIRT2127188	hsa-miR-615-5p	CLIP-seq
MIRT1424297	hsa-miR-1299	CLIP-seq
MIRT2461461	hsa-miR-4660	CLIP-seq
MIRT2461462	hsa-miR-548k	CLIP-seq
MIRT2461463	hsa-miR-548n	CLIP-seq
MIRT1424320	hsa-miR-875-3p	CLIP-seq
MIRT2642111	hsa-miR-10a	CLIP-seq
MIRT2642112	hsa-miR-10b	CLIP-seq
MIRT2642113	hsa-miR-1182	CLIP-seq
MIRT2642114	hsa-miR-1200	CLIP-seq
MIRT2642115	hsa-miR-1207-3p	CLIP-seq
MIRT2642116	hsa-miR-1207-5p	CLIP-seq
MIRT2642117	hsa-miR-1224-3p	CLIP-seq
MIRT2642118	hsa-miR-1253	CLIP-seq
MIRT2349030	hsa-miR-1263	CLIP-seq
MIRT2642119	hsa-miR-1270	CLIP-seq
MIRT2642120	hsa-miR-1272	CLIP-seq
MIRT2642121	hsa-miR-1275	CLIP-seq
MIRT2642122	hsa-miR-128	CLIP-seq
MIRT1424296	hsa-miR-1287	CLIP-seq
MIRT2642123	hsa-miR-1293	CLIP-seq
MIRT2349031	hsa-miR-129-3p	CLIP-seq
MIRT2433906	hsa-miR-1294	CLIP-seq
MIRT2127177	hsa-miR-129-5p	CLIP-seq
MIRT1424297	hsa-miR-1299	CLIP-seq
MIRT2642124	hsa-miR-1301	CLIP-seq
MIRT1424298	hsa-miR-1302	CLIP-seq
MIRT2642125	hsa-miR-1304	CLIP-seq
MIRT2642126	hsa-miR-1321	CLIP-seq
MIRT2642127	hsa-miR-1324	CLIP-seq
MIRT1424299	hsa-miR-136	CLIP-seq
MIRT2433908	hsa-miR-147b	CLIP-seq
MIRT2642128	hsa-miR-150	CLIP-seq
MIRT2642129	hsa-miR-1827	CLIP-seq
MIRT2642130	hsa-miR-1914	CLIP-seq
MIRT2642131	hsa-miR-1915	CLIP-seq
MIRT2349032	hsa-miR-193a-5p	CLIP-seq
MIRT2642132	hsa-miR-1973	CLIP-seq
MIRT2642133	hsa-miR-214	CLIP-seq
MIRT2433909	hsa-miR-2355-3p	CLIP-seq
MIRT2642134	hsa-miR-2467-5p	CLIP-seq
MIRT2642135	hsa-miR-2682	CLIP-seq
MIRT2642136	hsa-miR-296-5p	CLIP-seq
MIRT2642137	hsa-miR-3074-5p	CLIP-seq
MIRT2349034	hsa-miR-3121-5p	CLIP-seq
MIRT1424300	hsa-miR-3122	CLIP-seq
MIRT2642138	hsa-miR-3126-5p	CLIP-seq
MIRT2441105	hsa-miR-3130-3p	CLIP-seq
MIRT2642139	hsa-miR-3140-3p	CLIP-seq
MIRT2642140	hsa-miR-3153	CLIP-seq
MIRT2642141	hsa-miR-3156-3p	CLIP-seq
MIRT2642142	hsa-miR-3173-3p	CLIP-seq
MIRT2642143	hsa-miR-3184	CLIP-seq
MIRT2127178	hsa-miR-3188	CLIP-seq
MIRT2642144	hsa-miR-3192	CLIP-seq
MIRT2642145	hsa-miR-3199	CLIP-seq
MIRT2127180	hsa-miR-323b-5p	CLIP-seq
MIRT2642146	hsa-miR-326	CLIP-seq
MIRT2642147	hsa-miR-330-5p	CLIP-seq
MIRT2642148	hsa-miR-345	CLIP-seq
MIRT2642149	hsa-miR-3612	CLIP-seq
MIRT2642150	hsa-miR-3619-5p	CLIP-seq
MIRT2642151	hsa-miR-3622a-3p	CLIP-seq
MIRT2642152	hsa-miR-3622b-3p	CLIP-seq
MIRT2642153	hsa-miR-3655	CLIP-seq
MIRT2642154	hsa-miR-3663-5p	CLIP-seq
MIRT2349037	hsa-miR-3674	CLIP-seq
MIRT1424302	hsa-miR-3689a-3p	CLIP-seq
MIRT1424303	hsa-miR-3689c	CLIP-seq
MIRT2642155	hsa-miR-3691-3p	CLIP-seq
MIRT2642156	hsa-miR-3692	CLIP-seq
MIRT2642157	hsa-miR-371-5p	CLIP-seq
MIRT2642158	hsa-miR-371b-5p	CLIP-seq
MIRT2433912	hsa-miR-3909	CLIP-seq
MIRT1424304	hsa-miR-3913-5p	CLIP-seq
MIRT2642159	hsa-miR-3918	CLIP-seq
MIRT2441106	hsa-miR-3919	CLIP-seq
MIRT2642160	hsa-miR-3926	CLIP-seq
MIRT2433913	hsa-miR-3944-5p	CLIP-seq
MIRT2642161	hsa-miR-3975	CLIP-seq
MIRT2642162	hsa-miR-412	CLIP-seq
MIRT2642163	hsa-miR-423-5p	CLIP-seq
MIRT2127181	hsa-miR-4251	CLIP-seq
MIRT2642164	hsa-miR-4257	CLIP-seq
MIRT1424306	hsa-miR-4270	CLIP-seq
MIRT2127182	hsa-miR-4279	CLIP-seq
MIRT2642165	hsa-miR-4281	CLIP-seq
MIRT2127183	hsa-miR-4286	CLIP-seq
MIRT2642166	hsa-miR-4293	CLIP-seq
MIRT1424307	hsa-miR-4298	CLIP-seq
MIRT1424308	hsa-miR-4300	CLIP-seq
MIRT2642167	hsa-miR-4301	CLIP-seq
MIRT2642168	hsa-miR-4314	CLIP-seq
MIRT2642169	hsa-miR-4318	CLIP-seq
MIRT2642170	hsa-miR-432	CLIP-seq
MIRT2642171	hsa-miR-4324	CLIP-seq
MIRT2642172	hsa-miR-4419a	CLIP-seq
MIRT2642173	hsa-miR-4421	CLIP-seq
MIRT2642174	hsa-miR-4423-3p	CLIP-seq
MIRT2642175	hsa-miR-4425	CLIP-seq
MIRT2642176	hsa-miR-4428	CLIP-seq
MIRT1424309	hsa-miR-4441	CLIP-seq
MIRT2642177	hsa-miR-4443	CLIP-seq
MIRT2642178	hsa-miR-4446-3p	CLIP-seq
MIRT2642179	hsa-miR-4447	CLIP-seq
MIRT1424310	hsa-miR-4453	CLIP-seq
MIRT2642180	hsa-miR-4464	CLIP-seq
MIRT2642181	hsa-miR-4472	CLIP-seq
MIRT2127185	hsa-miR-4474-3p	CLIP-seq
MIRT2642182	hsa-miR-4476	CLIP-seq
MIRT2642183	hsa-miR-4483	CLIP-seq
MIRT2642184	hsa-miR-4488	CLIP-seq
MIRT2642185	hsa-miR-4492	CLIP-seq
MIRT2642186	hsa-miR-4498	CLIP-seq
MIRT2642187	hsa-miR-449c	CLIP-seq
MIRT2642188	hsa-miR-4502	CLIP-seq
MIRT2642189	hsa-miR-4505	CLIP-seq
MIRT2642190	hsa-miR-4510	CLIP-seq
MIRT2642191	hsa-miR-4533	CLIP-seq
MIRT1424312	hsa-miR-4538	CLIP-seq
MIRT1424313	hsa-miR-4639-3p	CLIP-seq
MIRT2642192	hsa-miR-4640-5p	CLIP-seq
MIRT2642193	hsa-miR-4645-5p	CLIP-seq
MIRT2642194	hsa-miR-4646-5p	CLIP-seq
MIRT2642195	hsa-miR-4651	CLIP-seq
MIRT2461461	hsa-miR-4660	CLIP-seq
MIRT2441107	hsa-miR-4661-3p	CLIP-seq
MIRT2642196	hsa-miR-4665-5p	CLIP-seq
MIRT2642197	hsa-miR-4668-5p	CLIP-seq
MIRT2642198	hsa-miR-4669	CLIP-seq
MIRT2642199	hsa-miR-4673	CLIP-seq
MIRT2642200	hsa-miR-4680-5p	CLIP-seq
MIRT2642201	hsa-miR-4683	CLIP-seq
MIRT2349040	hsa-miR-4687-5p	CLIP-seq
MIRT2642202	hsa-miR-4688	CLIP-seq
MIRT2642203	hsa-miR-4690-3p	CLIP-seq
MIRT2642204	hsa-miR-4691-5p	CLIP-seq
MIRT2642205	hsa-miR-4697-5p	CLIP-seq
MIRT2433916	hsa-miR-4708-5p	CLIP-seq
MIRT2433917	hsa-miR-4710	CLIP-seq
MIRT2642206	hsa-miR-4713-5p	CLIP-seq
MIRT1424314	hsa-miR-4717-3p	CLIP-seq
MIRT2642207	hsa-miR-4721	CLIP-seq
MIRT2642208	hsa-miR-4723-5p	CLIP-seq
MIRT2642209	hsa-miR-4726-3p	CLIP-seq
MIRT2642210	hsa-miR-4726-5p	CLIP-seq
MIRT2642211	hsa-miR-4728-5p	CLIP-seq
MIRT2642212	hsa-miR-4731-5p	CLIP-seq
MIRT2642213	hsa-miR-4739	CLIP-seq
MIRT2642214	hsa-miR-4747-3p	CLIP-seq
MIRT2642215	hsa-miR-4748	CLIP-seq
MIRT2441108	hsa-miR-4756-3p	CLIP-seq
MIRT2642216	hsa-miR-4756-5p	CLIP-seq
MIRT2642217	hsa-miR-4758-3p	CLIP-seq
MIRT2127186	hsa-miR-4761-5p	CLIP-seq
MIRT2642218	hsa-miR-4763-3p	CLIP-seq
MIRT2433919	hsa-miR-4773	CLIP-seq
MIRT2642219	hsa-miR-4777-3p	CLIP-seq
MIRT2642220	hsa-miR-4779	CLIP-seq
MIRT2441109	hsa-miR-4793-3p	CLIP-seq
MIRT2642221	hsa-miR-4793-5p	CLIP-seq
MIRT2642222	hsa-miR-483-3p	CLIP-seq
MIRT2642223	hsa-miR-485-5p	CLIP-seq
MIRT2642224	hsa-miR-501-5p	CLIP-seq
MIRT2642225	hsa-miR-5047	CLIP-seq
MIRT2642226	hsa-miR-516a-3p	CLIP-seq
MIRT2642227	hsa-miR-519e	CLIP-seq
MIRT2642228	hsa-miR-532-3p	CLIP-seq
MIRT2642229	hsa-miR-544b	CLIP-seq
MIRT2642230	hsa-miR-548aa	CLIP-seq
MIRT2433922	hsa-miR-548b-3p	CLIP-seq
MIRT2461462	hsa-miR-548k	CLIP-seq
MIRT2461463	hsa-miR-548n	CLIP-seq
MIRT2127187	hsa-miR-580	CLIP-seq
MIRT2642231	hsa-miR-591	CLIP-seq
MIRT2642232	hsa-miR-608	CLIP-seq
MIRT2127188	hsa-miR-615-5p	CLIP-seq
MIRT2642233	hsa-miR-620	CLIP-seq
MIRT1424317	hsa-miR-635	CLIP-seq
MIRT2642234	hsa-miR-637	CLIP-seq
MIRT2642235	hsa-miR-642a	CLIP-seq
MIRT2642236	hsa-miR-646	CLIP-seq
MIRT2642237	hsa-miR-650	CLIP-seq
MIRT2433923	hsa-miR-658	CLIP-seq
MIRT2127189	hsa-miR-659	CLIP-seq
MIRT1424318	hsa-miR-671-5p	CLIP-seq
MIRT2433924	hsa-miR-676	CLIP-seq
MIRT2642238	hsa-miR-761	CLIP-seq
MIRT2642239	hsa-miR-762	CLIP-seq
MIRT1424320	hsa-miR-875-3p	CLIP-seq
MIRT2642240	hsa-miR-890	CLIP-seq
MIRT1424321	hsa-miR-920	CLIP-seq
MIRT2642241	hsa-miR-938	CLIP-seq
MIRT2693161	hsa-miR-103a	CLIP-seq
MIRT2693162	hsa-miR-107	CLIP-seq
MIRT2642111	hsa-miR-10a	CLIP-seq
MIRT2642112	hsa-miR-10b	CLIP-seq
MIRT2642113	hsa-miR-1182	CLIP-seq
MIRT2642114	hsa-miR-1200	CLIP-seq
MIRT2642115	hsa-miR-1207-3p	CLIP-seq
MIRT2642116	hsa-miR-1207-5p	CLIP-seq
MIRT2642117	hsa-miR-1224-3p	CLIP-seq
MIRT2693163	hsa-miR-1226	CLIP-seq
MIRT1424294	hsa-miR-1237	CLIP-seq
MIRT1424295	hsa-miR-1248	CLIP-seq
MIRT2642118	hsa-miR-1253	CLIP-seq
MIRT2349030	hsa-miR-1263	CLIP-seq
MIRT2642120	hsa-miR-1272	CLIP-seq
MIRT2642121	hsa-miR-1275	CLIP-seq
MIRT2642122	hsa-miR-128	CLIP-seq
MIRT2642123	hsa-miR-1293	CLIP-seq
MIRT2349031	hsa-miR-129-3p	CLIP-seq
MIRT2433906	hsa-miR-1294	CLIP-seq
MIRT2127177	hsa-miR-129-5p	CLIP-seq
MIRT1424297	hsa-miR-1299	CLIP-seq
MIRT2642124	hsa-miR-1301	CLIP-seq
MIRT1424298	hsa-miR-1302	CLIP-seq
MIRT2642125	hsa-miR-1304	CLIP-seq
MIRT2642126	hsa-miR-1321	CLIP-seq
MIRT2642127	hsa-miR-1324	CLIP-seq
MIRT1424299	hsa-miR-136	CLIP-seq
MIRT2433908	hsa-miR-147b	CLIP-seq
MIRT2642128	hsa-miR-150	CLIP-seq
MIRT2693164	hsa-miR-151-5p	CLIP-seq
MIRT2693165	hsa-miR-151b	CLIP-seq
MIRT2642129	hsa-miR-1827	CLIP-seq
MIRT2642130	hsa-miR-1914	CLIP-seq
MIRT2642131	hsa-miR-1915	CLIP-seq
MIRT2349032	hsa-miR-193a-5p	CLIP-seq
MIRT2642132	hsa-miR-1973	CLIP-seq
MIRT2642133	hsa-miR-214	CLIP-seq
MIRT2433909	hsa-miR-2355-3p	CLIP-seq
MIRT2642134	hsa-miR-2467-5p	CLIP-seq
MIRT2642135	hsa-miR-2682	CLIP-seq
MIRT2642136	hsa-miR-296-5p	CLIP-seq
MIRT2642137	hsa-miR-3074-5p	CLIP-seq
MIRT2349034	hsa-miR-3121-5p	CLIP-seq
MIRT1424300	hsa-miR-3122	CLIP-seq
MIRT2642138	hsa-miR-3126-5p	CLIP-seq
MIRT2441105	hsa-miR-3130-3p	CLIP-seq
MIRT1554765	hsa-miR-3132	CLIP-seq
MIRT2642139	hsa-miR-3140-3p	CLIP-seq
MIRT2642140	hsa-miR-3153	CLIP-seq
MIRT2642141	hsa-miR-3156-3p	CLIP-seq
MIRT2642142	hsa-miR-3173-3p	CLIP-seq
MIRT2642143	hsa-miR-3184	CLIP-seq
MIRT2127178	hsa-miR-3188	CLIP-seq
MIRT2642144	hsa-miR-3192	CLIP-seq
MIRT2642145	hsa-miR-3199	CLIP-seq
MIRT2127179	hsa-miR-323-5p	CLIP-seq
MIRT2127180	hsa-miR-323b-5p	CLIP-seq
MIRT2642146	hsa-miR-326	CLIP-seq
MIRT2642147	hsa-miR-330-5p	CLIP-seq
MIRT2642148	hsa-miR-345	CLIP-seq
MIRT2642149	hsa-miR-3612	CLIP-seq
MIRT2642150	hsa-miR-3619-5p	CLIP-seq
MIRT2642151	hsa-miR-3622a-3p	CLIP-seq
MIRT2642152	hsa-miR-3622b-3p	CLIP-seq
MIRT2642153	hsa-miR-3655	CLIP-seq
MIRT2349037	hsa-miR-3674	CLIP-seq
MIRT1424302	hsa-miR-3689a-3p	CLIP-seq
MIRT1424303	hsa-miR-3689c	CLIP-seq
MIRT2642155	hsa-miR-3691-3p	CLIP-seq
MIRT2642156	hsa-miR-3692	CLIP-seq
MIRT2642157	hsa-miR-371-5p	CLIP-seq
MIRT2642158	hsa-miR-371b-5p	CLIP-seq
MIRT2433912	hsa-miR-3909	CLIP-seq
MIRT1424304	hsa-miR-3913-5p	CLIP-seq
MIRT2642159	hsa-miR-3918	CLIP-seq
MIRT2441106	hsa-miR-3919	CLIP-seq
MIRT2642160	hsa-miR-3926	CLIP-seq
MIRT2693166	hsa-miR-3935	CLIP-seq
MIRT2433913	hsa-miR-3944-5p	CLIP-seq
MIRT2642161	hsa-miR-3975	CLIP-seq
MIRT2642162	hsa-miR-412	CLIP-seq
MIRT2642163	hsa-miR-423-5p	CLIP-seq
MIRT2127181	hsa-miR-4251	CLIP-seq
MIRT2642164	hsa-miR-4257	CLIP-seq
MIRT1424306	hsa-miR-4270	CLIP-seq
MIRT2127182	hsa-miR-4279	CLIP-seq
MIRT2127183	hsa-miR-4286	CLIP-seq
MIRT2127184	hsa-miR-4290	CLIP-seq
MIRT2642166	hsa-miR-4293	CLIP-seq
MIRT1424307	hsa-miR-4298	CLIP-seq
MIRT1424308	hsa-miR-4300	CLIP-seq
MIRT2642167	hsa-miR-4301	CLIP-seq
MIRT2642168	hsa-miR-4314	CLIP-seq
MIRT2642169	hsa-miR-4318	CLIP-seq
MIRT2642170	hsa-miR-432	CLIP-seq
MIRT2642171	hsa-miR-4324	CLIP-seq
MIRT2642172	hsa-miR-4419a	CLIP-seq
MIRT2642173	hsa-miR-4421	CLIP-seq
MIRT2642174	hsa-miR-4423-3p	CLIP-seq
MIRT2642175	hsa-miR-4425	CLIP-seq
MIRT2642176	hsa-miR-4428	CLIP-seq
MIRT2693167	hsa-miR-4436a	CLIP-seq
MIRT1424309	hsa-miR-4441	CLIP-seq
MIRT2642177	hsa-miR-4443	CLIP-seq
MIRT2642178	hsa-miR-4446-3p	CLIP-seq
MIRT2642179	hsa-miR-4447	CLIP-seq
MIRT1424310	hsa-miR-4453	CLIP-seq
MIRT2642180	hsa-miR-4464	CLIP-seq
MIRT2642181	hsa-miR-4472	CLIP-seq
MIRT2127185	hsa-miR-4474-3p	CLIP-seq
MIRT2642182	hsa-miR-4476	CLIP-seq
MIRT2642183	hsa-miR-4483	CLIP-seq
MIRT2642184	hsa-miR-4488	CLIP-seq
MIRT2642185	hsa-miR-4492	CLIP-seq
MIRT2642186	hsa-miR-4498	CLIP-seq
MIRT2642187	hsa-miR-449c	CLIP-seq
MIRT2642188	hsa-miR-4502	CLIP-seq
MIRT2642189	hsa-miR-4505	CLIP-seq
MIRT2642190	hsa-miR-4510	CLIP-seq
MIRT2642191	hsa-miR-4533	CLIP-seq
MIRT1424312	hsa-miR-4538	CLIP-seq
MIRT1424313	hsa-miR-4639-3p	CLIP-seq
MIRT2642192	hsa-miR-4640-5p	CLIP-seq
MIRT2642193	hsa-miR-4645-5p	CLIP-seq
MIRT2642194	hsa-miR-4646-5p	CLIP-seq
MIRT2642195	hsa-miR-4651	CLIP-seq
MIRT2461461	hsa-miR-4660	CLIP-seq
MIRT2441107	hsa-miR-4661-3p	CLIP-seq
MIRT2642196	hsa-miR-4665-5p	CLIP-seq
MIRT2693168	hsa-miR-4667-5p	CLIP-seq
MIRT2642197	hsa-miR-4668-5p	CLIP-seq
MIRT2642199	hsa-miR-4673	CLIP-seq
MIRT2642200	hsa-miR-4680-5p	CLIP-seq
MIRT2349040	hsa-miR-4687-5p	CLIP-seq
MIRT2642202	hsa-miR-4688	CLIP-seq
MIRT2642203	hsa-miR-4690-3p	CLIP-seq
MIRT2642204	hsa-miR-4691-5p	CLIP-seq
MIRT2642205	hsa-miR-4697-5p	CLIP-seq
MIRT2693169	hsa-miR-4700-5p	CLIP-seq
MIRT2433917	hsa-miR-4710	CLIP-seq
MIRT2642206	hsa-miR-4713-5p	CLIP-seq
MIRT1424314	hsa-miR-4717-3p	CLIP-seq
MIRT2693170	hsa-miR-4719	CLIP-seq
MIRT2642207	hsa-miR-4721	CLIP-seq
MIRT2642208	hsa-miR-4723-5p	CLIP-seq
MIRT2642209	hsa-miR-4726-3p	CLIP-seq
MIRT2642210	hsa-miR-4726-5p	CLIP-seq
MIRT2642211	hsa-miR-4728-5p	CLIP-seq
MIRT2642212	hsa-miR-4731-5p	CLIP-seq
MIRT2642213	hsa-miR-4739	CLIP-seq
MIRT2693171	hsa-miR-4742-5p	CLIP-seq
MIRT2642214	hsa-miR-4747-3p	CLIP-seq
MIRT2642215	hsa-miR-4748	CLIP-seq
MIRT2441108	hsa-miR-4756-3p	CLIP-seq
MIRT2642216	hsa-miR-4756-5p	CLIP-seq
MIRT2642217	hsa-miR-4758-3p	CLIP-seq
MIRT2127186	hsa-miR-4761-5p	CLIP-seq
MIRT2642218	hsa-miR-4763-3p	CLIP-seq
MIRT2693172	hsa-miR-4763-5p	CLIP-seq
MIRT2433919	hsa-miR-4773	CLIP-seq
MIRT2642219	hsa-miR-4777-3p	CLIP-seq
MIRT2642220	hsa-miR-4779	CLIP-seq
MIRT2441109	hsa-miR-4793-3p	CLIP-seq
MIRT2642221	hsa-miR-4793-5p	CLIP-seq
MIRT2642222	hsa-miR-483-3p	CLIP-seq
MIRT2642223	hsa-miR-485-5p	CLIP-seq
MIRT2642224	hsa-miR-501-5p	CLIP-seq
MIRT2642225	hsa-miR-5047	CLIP-seq
MIRT2693173	hsa-miR-512-3p	CLIP-seq
MIRT1424316	hsa-miR-515-5p	CLIP-seq
MIRT2642226	hsa-miR-516a-3p	CLIP-seq
MIRT2642227	hsa-miR-519e	CLIP-seq
MIRT2642228	hsa-miR-532-3p	CLIP-seq
MIRT2642229	hsa-miR-544b	CLIP-seq
MIRT2642230	hsa-miR-548aa	CLIP-seq
MIRT2433922	hsa-miR-548b-3p	CLIP-seq
MIRT2461462	hsa-miR-548k	CLIP-seq
MIRT2461463	hsa-miR-548n	CLIP-seq
MIRT2693174	hsa-miR-577	CLIP-seq
MIRT2127187	hsa-miR-580	CLIP-seq
MIRT2642231	hsa-miR-591	CLIP-seq
MIRT2642232	hsa-miR-608	CLIP-seq
MIRT2127188	hsa-miR-615-5p	CLIP-seq
MIRT2693175	hsa-miR-626	CLIP-seq
MIRT1424317	hsa-miR-635	CLIP-seq
MIRT2642234	hsa-miR-637	CLIP-seq
MIRT2642235	hsa-miR-642a	CLIP-seq
MIRT2642236	hsa-miR-646	CLIP-seq
MIRT2642237	hsa-miR-650	CLIP-seq
MIRT2433923	hsa-miR-658	CLIP-seq
MIRT2127189	hsa-miR-659	CLIP-seq
MIRT1424318	hsa-miR-671-5p	CLIP-seq
MIRT2433924	hsa-miR-676	CLIP-seq
MIRT2642238	hsa-miR-761	CLIP-seq
MIRT2642239	hsa-miR-762	CLIP-seq
MIRT1424320	hsa-miR-875-3p	CLIP-seq
MIRT2127190	hsa-miR-876-3p	CLIP-seq
MIRT2642240	hsa-miR-890	CLIP-seq
MIRT1424321	hsa-miR-920	CLIP-seq
MIRT2642241	hsa-miR-938	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
POU5F1	Activation	17068183

Show/Hide all (69)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	ISS
GO:0001952	Process	Regulation of cell-matrix adhesion	IMP	9749990
GO:0002682	Process	Regulation of immune system process	IEA
GO:0002693	Process	Positive regulation of cellular extravasation	IDA	15004192
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	ISS
GO:0005178	Function	Integrin binding	IEA
GO:0005178	Function	Integrin binding	IMP	18346467
GO:0005178	Function	Integrin binding	IPI	15004192
GO:0005515	Function	Protein binding	IPI	7513706, 22210915, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	2864289
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006469	Process	Negative regulation of protein kinase activity	ISS
GO:0007010	Process	Cytoskeleton organization	ISS
GO:0007155	Process	Cell adhesion	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	18346467
GO:0007267	Process	Cell-cell signaling	IEA
GO:0007267	Process	Cell-cell signaling	ISS	22479590
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009897	Component	External side of plasma membrane	ISS
GO:0009986	Component	Cell surface	IDA	9749990
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	14757759
GO:0030334	Process	Regulation of cell migration	IEA
GO:0030336	Process	Negative regulation of cell migration	ISS
GO:0030425	Component	Dendrite	IBA
GO:0030425	Component	Dendrite	IEA
GO:0030426	Component	Growth cone	ISS
GO:0030673	Component	Axolemma	ISS
GO:0032590	Component	Dendrite membrane	ISS
GO:0032809	Component	Neuronal cell body membrane	ISS
GO:0034113	Process	Heterotypic cell-cell adhesion	IDA	15004192
GO:0034235	Function	GPI anchor binding	ISS
GO:0043113	Process	Receptor clustering	ISS
GO:0043547	Process	Positive regulation of GTPase activity	ISS
GO:0045121	Component	Membrane raft	IBA
GO:0045121	Component	Membrane raft	IEA
GO:0045121	Component	Membrane raft	NAS	15093746
GO:0045785	Process	Positive regulation of cell adhesion	IEA
GO:0046549	Process	Retinal cone cell development	IEA
GO:0046549	Process	Retinal cone cell development	ISS
GO:0048041	Process	Focal adhesion assembly	ISS
GO:0050771	Process	Negative regulation of axonogenesis	ISS
GO:0050852	Process	T cell receptor signaling pathway	ISS
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IEA
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	ISS
GO:0050870	Process	Positive regulation of T cell activation	ISS
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	ISS
GO:0051894	Process	Positive regulation of focal adhesion assembly	IBA
GO:0051894	Process	Positive regulation of focal adhesion assembly	IEA
GO:0051894	Process	Positive regulation of focal adhesion assembly	IMP	18346467
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070571	Process	Negative regulation of neuron projection regeneration	IEA
GO:0070571	Process	Negative regulation of neuron projection regeneration	ISS	22479590
GO:0098552	Component	Side of membrane	IEA
GO:0098609	Process	Cell-cell adhesion	ISS
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA

MIM	HGNC	e!Ensembl
188230	11801	ENSG00000154096

P04216

Protein name

Thy-1 membrane glycoprotein (CDw90) (Thy-1 antigen) (CD antigen CD90)

Protein function

May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00047	ig	21 → 119	Immunoglobulin domain	Domain

Sequence

MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKK
HVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNV
TVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL

Sequence length

161

Interactions

View interactions

	KEGG		Reactome
	Leukocyte transendothelial migration		Post-translational modification: synthesis of GPI-anchored proteins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (228)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	20303356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	7540889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10557051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	27761727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28744021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolitis Extrinsic Allergic	Extrinsic allergic alveolitis	Pubtator	27792269	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	25040401, 34556089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	27737362	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	16566922, 20807312, 22047141, 28100513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	21735473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	23301671, 31584382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	15734970		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29301827, 30954649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29570822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	22251373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	35168627	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	22251373, 29476097, 31061532, 34435471, 35309353, 37060003, 37298499	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35168627	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	11493762, 1969227, 2220826, 2331673, 8406440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	1969227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29570822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	30008326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	29245016		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	1742746, 20403334		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	30837609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	28263294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	32867782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23090904, 26191205, 29949609, 30482778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22791584, 23090904, 24194916, 25287138, 25525832, 26191205, 27070671, 32867782, 35045088, 35296631, 36940196	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms Male	Male breast neoplasms	Pubtator	24194916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	31799226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	34358255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	38254918	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	27761727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	28499650	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19686584, 20511115, 21737452, 22203689, 22606345, 22799330, 24616575, 25061736, 26272696, 27174710, 29251325, 29515105, 29722127, 30600675, 31383828 View all (4 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	37207705	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23469181, 24101104, 27761727, 28744021, 30018518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	24194916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	31735168	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	27332878, 33242496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34358255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	12781446, 15104276, 16102586, 31735168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	15380042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29278729, 31805305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28865749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	25040401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	25100292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	37114052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	22826509	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26595254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	10557051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	23625284, 31633754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	31633754	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	27155399, 30775942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	1990836	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34126803	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34678202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	1671006, 1982251, 1990836, 31209568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	19228591	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	30020448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	28325116, 28992748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	12077275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	31735168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	23382045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	23382045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32255255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	7509624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	31196492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	27768790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28287406, 30365941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	40084998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Tendon Sheath	Giant cell tumor of tendon sheath	Pubtator	34855235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22203689, 23436586, 35287174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28453745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28453745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	22203689, 27757723, 29590646	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29348889, 29590646, 30368520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	11729228, 15372454, 25879629, 28054119, 31152928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis, Membranoproliferative	Glomerulonephritis	BEFREE	16736195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	22736938, 24751986, 33507228	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hair Diseases	Hair Diseases	BEFREE	28220862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	39619326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	37390254, 38065888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	16456130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	31383828	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	25168019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	34685577	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	27569062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	27569062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	22938014	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	29789575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29805477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	16049324, 18556592, 21577212, 22938014, 29273797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	21577212, 22938014	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	18242515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28865749, 29859873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	26067666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	30196535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intussusception	Intussusception	BEFREE	28859090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	10557051, 25102944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	2888537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	31855296	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	19805552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10557051, 30829648, 3248386, 6771002, 7540889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	7540889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	18061946, 7540889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10557051, 26010294, 29630051, 9129012, 9225063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	10557051		★★★★★ ★☆☆☆☆ Found in Text Mining only
LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	BEFREE	23469181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18242515, 18925631, 21735473, 22606345, 23237599, 23438193, 23469181, 24116172, 25561791, 25672610, 28182993, 28645561, 28900199, 29251325, 30536969, 31828297 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	30365941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	31383828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	31383828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	LHGDN	18242515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	21735473, 24116172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	22799330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28499650, 37783508	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	25986394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	25986394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	1371997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	29898964, 6771002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	17570320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	24090655, 28453745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23090904, 24194916, 26191205, 29949609, 30482778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	23382045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	18242515, 22606345, 23438193, 23861222, 26272696, 29251325, 29722127, 31696964, 31740785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23469181, 24101104, 28744021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	12781446, 15104276, 16102586, 31735168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29483967, 30954649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11406532, 17342746, 19267366, 20562849, 30488530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20043075, 26329007, 27633757, 31123165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18556592, 18925631, 19267366, 20562849, 24116172, 25986394, 26272696, 26329007, 27062695, 27337957, 27761727, 28245426, 28455240, 28499650, 29301827 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29949609		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12074634, 15897908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25216363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	17622271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	29468444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	27761727, 29527515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	21835491	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	25040401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multicystic Dysplastic Kidney	Multicystic dysplastic kidney	Pubtator	27737362	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	38282008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	1281618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	12070035, 17616640, 22753872, 27683035, 9885439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	12070035, 17616640, 18061946, 20662087, 22753872, 30334347, 7540889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	25193869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10557051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29341439, 31332256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	29559994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	35751644	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	16007174, 18027848, 19921696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12781446, 14555989, 15104276, 16007174, 16102586, 17952444, 17975224, 19482697, 19737398, 19921696, 20562849, 21743497, 22314551, 22606345, 23097628 View all (23 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	15372454, 16316330, 16458938, 16736195, 25879629, 28039298, 29568121, 30235450, 30404815, 31312364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	20187302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17952444, 2865325, 2884261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	18630512, 33452207, 36571449	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28962574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	29941005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23426441, 28499650, 28878242, 31344049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	16059715, 34419146	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28329833, 30333974, 30376360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuropathy	Optic Neuropathy	BEFREE	31063183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	14609532, 21953087, 37390254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	27155399, 35168627	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30333974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30089635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	32999266	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	12781446, 15104276, 16102586, 31735168		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	12781446, 15104276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17579858, 25525832, 31735168, 37628927	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29483967, 30954649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	29301827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25536077	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	17879265, 18463504, 22350713, 24844147, 25588356, 26666562, 29246324, 29541535, 29718367, 30127714, 30146452, 31125602, 31440136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	24844147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	8426120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	33261069	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	16603627	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	9695410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	9695410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	9695410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	25193869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11406532, 17342746, 19267366, 20562849, 30488530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15509525, 19267366, 20562849, 30488530	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	19737398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23936228	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	18556592, 28165468, 28263294, 30829553, 31249375, 31672942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anaemia with excess blasts	Myelodysplastic syndrome	BEFREE	9885439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	CTD_human_DG	23075401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	9222276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	27495116, 31061532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	2896356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	30546937, 30964118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	24498265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	30320623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	16207328	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	25986394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	10995209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Serum Sickness	Serum Sickness	BEFREE	15372454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	15104276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	6121832	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	2487682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	23469181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	28075524, 34228218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23469181, 27761727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23382045, 28449469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25647013	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27931212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20043075, 26329007, 27633757, 31123165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	21743497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31123165, 33788653, 37378943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	38254918	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	26067666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	28724609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	25986394, 30320623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thromboangiitis Obliterans	Thromboangiitis obliterans	Pubtator	20529829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	8396667, 8426120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	LHGDN	18976167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	28938397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	23301671	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28039356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36999020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	27716046	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	30723390	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	27332878	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	19657392, 30008326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

THY1 (Thy-1 cell surface antigen)