Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7069
Gene name	Thyroid hormone responsive
Gene symbol	THRSP
Synonyms (NCBI Gene)	LPGP1LpgpS14SPOT14THRP
Chromosome	11
Chromosome location	11q14.1
Summary	The protein encoded by this gene is similar to the gene product of S14, a rat gene whose expression is limited to liver and adipose tissue and is controlled by nutritional and hormonal factors. This gene has been shown to be expressed in liver and adipocy

Show/Hide all (45)

miRTarBase ID	miRNA	Experiments
MIRT1423708	hsa-miR-129-3p	CLIP-seq
MIRT1423709	hsa-miR-302a	CLIP-seq
MIRT1423710	hsa-miR-302b	CLIP-seq
MIRT1423711	hsa-miR-302c	CLIP-seq
MIRT1423712	hsa-miR-302d	CLIP-seq
MIRT1423713	hsa-miR-302e	CLIP-seq
MIRT1423714	hsa-miR-3140-3p	CLIP-seq
MIRT1423715	hsa-miR-372	CLIP-seq
MIRT1423716	hsa-miR-373	CLIP-seq
MIRT1423717	hsa-miR-4480	CLIP-seq
MIRT1423718	hsa-miR-4687-5p	CLIP-seq
MIRT1423719	hsa-miR-4717-3p	CLIP-seq
MIRT1423720	hsa-miR-520a-3p	CLIP-seq
MIRT1423721	hsa-miR-520b	CLIP-seq
MIRT1423722	hsa-miR-520c-3p	CLIP-seq
MIRT1423723	hsa-miR-520d-3p	CLIP-seq
MIRT1423724	hsa-miR-520e	CLIP-seq
MIRT1423725	hsa-miR-520f	CLIP-seq
MIRT2126924	hsa-miR-1290	CLIP-seq
MIRT2126925	hsa-miR-3167	CLIP-seq
MIRT2126926	hsa-miR-876-5p	CLIP-seq
MIRT2348872	hsa-let-7a	CLIP-seq
MIRT2348873	hsa-let-7b	CLIP-seq
MIRT2348874	hsa-let-7c	CLIP-seq
MIRT2348875	hsa-let-7d	CLIP-seq
MIRT2348876	hsa-let-7e	CLIP-seq
MIRT2348877	hsa-let-7f	CLIP-seq
MIRT2348878	hsa-let-7g	CLIP-seq
MIRT2348879	hsa-let-7i	CLIP-seq
MIRT2348880	hsa-miR-1294	CLIP-seq
MIRT2348881	hsa-miR-202	CLIP-seq
MIRT2348882	hsa-miR-2110	CLIP-seq
MIRT2348883	hsa-miR-3150a-3p	CLIP-seq
MIRT2348884	hsa-miR-3175	CLIP-seq
MIRT2348885	hsa-miR-3927	CLIP-seq
MIRT2348886	hsa-miR-3935	CLIP-seq
MIRT2348887	hsa-miR-4316	CLIP-seq
MIRT2348888	hsa-miR-4458	CLIP-seq
MIRT2348889	hsa-miR-4500	CLIP-seq
MIRT2348890	hsa-miR-4716-3p	CLIP-seq
MIRT2348891	hsa-miR-4723-5p	CLIP-seq
MIRT2348892	hsa-miR-577	CLIP-seq
MIRT2348893	hsa-miR-656	CLIP-seq
MIRT2348894	hsa-miR-939	CLIP-seq
MIRT2348895	hsa-miR-98	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
NR1I2	Activation	19437491
SREBF1	Unknown	22672904

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	TAS	9003802
GO:0009617	Process	Response to bacterium	IEA
GO:0010866	Process	Regulation of triglyceride biosynthetic process	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0046890	Process	Regulation of lipid biosynthetic process	IBA
GO:0046890	Process	Regulation of lipid biosynthetic process	IEA
GO:0046890	Process	Regulation of lipid biosynthetic process	ISS
GO:0140678	Function	Molecular function inhibitor activity	IEA

MIM	HGNC	e!Ensembl
601926	11800	ENSG00000151365

Q92748

Protein name

Thyroid hormone-inducible hepatic protein (Spot 14 protein) (S14) (SPOT14)

Protein function

Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its i

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07084	Spot_14	1 → 145	Thyroid hormone-inducible hepatic protein Spot 14	Family

Tissue specificity

TISSUE SPECIFICITY: Mainly expressed in tissues that synthesize triglycerides.

Sequence

MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYF
TMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSL
HHILMHLTEKAQEVTRKYQEMTGQVW

Sequence length

146

Interactions

View interactions

	Reactome
			Carnitine metabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (24)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	27082501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	30138648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10694501, 16300755, 16809441, 19116881, 9618526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15819613, 19116881, 23417336, 9618526	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15819613	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	16316942		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35196258	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized Thyroid Hormone Resistance	Thyroid Hormone Resistance	BEFREE	16444158		★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	19116881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	19116881	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12183076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	35945747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10694501, 16300755, 16809441, 19116881, 9618526, 9777755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16300755, 25472762, 9618526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30763384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25472762, 9618526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29604329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19360007, 30763384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	21765106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Hormone Resistance Syndrome	Thyroid Hormone Resistance	BEFREE	16444158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	35945747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only

THRSP (thyroid hormone responsive)