THBS4 (thrombospondin 4)

Gene

• Entrez ID: 7060
• Gene name: Thrombospondin 4
• Gene symbol: THBS4
• Synonyms (NCBI Gene): TSP-4, TSP4
• Chromosome: 5
• Chromosome location: 5q14.1
• Summary: The protein encoded by this gene belongs to the thrombospondin protein family. Thrombospondin family members are adhesive glycoproteins that mediate cell-to-cell and cell-to-matrix interactions. This protein forms a pentamer and can bind to heparin and ca

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1423139	hsa-miR-137	CLIP-seq
MIRT1423140	hsa-miR-181a	CLIP-seq
MIRT1423141	hsa-miR-181b	CLIP-seq
MIRT1423142	hsa-miR-181c	CLIP-seq
MIRT1423143	hsa-miR-181d	CLIP-seq
MIRT1423144	hsa-miR-23a	CLIP-seq
MIRT1423145	hsa-miR-23b	CLIP-seq
MIRT1423146	hsa-miR-23c	CLIP-seq
MIRT1423147	hsa-miR-3064-3p	CLIP-seq
MIRT1423148	hsa-miR-4262	CLIP-seq
MIRT1423149	hsa-miR-4715-3p	CLIP-seq
MIRT1423150	hsa-miR-548ad	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IDA	12952849
GO:0005178	Function	Integrin binding	IDA	16099885
GO:0005509	Function	Calcium ion binding	IDA	7852353, 16246837
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	22682248
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005604	Component	Basement membrane	IDA	17927980
GO:0005615	Component	Extracellular space	IDA	12952849, 18802666
GO:0005615	Component	Extracellular space	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0006986	Process	Response to unfolded protein	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0008083	Function	Growth factor activity	IEA
GO:0008201	Function	Heparin binding	IDA	7852353
GO:0008201	Function	Heparin binding	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IEP	18802666
GO:0016529	Component	Sarcoplasmic reticulum	IEA
GO:0016529	Component	Sarcoplasmic reticulum	ISS
GO:0031012	Component	Extracellular matrix	IBA
GO:0031012	Component	Extracellular matrix	ISS
GO:0034103	Process	Regulation of tissue remodeling	IEA
GO:0034103	Process	Regulation of tissue remodeling	ISS
GO:0034976	Process	Response to endoplasmic reticulum stress	IBA
GO:0034976	Process	Response to endoplasmic reticulum stress	IEA
GO:0034976	Process	Response to endoplasmic reticulum stress	ISS
GO:0048266	Process	Behavioral response to pain	IEA
GO:0048266	Process	Behavioral response to pain	ISS
GO:0048771	Process	Tissue remodeling	IEA
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	16099885
GO:0051451	Process	Myoblast migration	IDA	7519904
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071603	Process	Endothelial cell-cell adhesion	IDA	12952849
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IDA	16099885

Other IDs

• MIM: 600715
• HGNC: 11788
• e!Ensembl: ENSG00000113296

Protein

• UniProt ID: P35443
• Protein name: Thrombospondin-4
• Protein function: Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions and is involved in various processes including cellular proliferation, migration, adhesion and attachment, inflammatory response to CNS injury, regulation of vascul
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11598	COMP	218 → 262	Cartilage oligomeric matrix protein	Family
  PF07645	EGF_CA	326 → 377	Calcium-binding EGF domain	Domain
  PF07645	EGF_CA	379 → 422	Calcium-binding EGF domain	Domain
  PF02412	TSP_3	496 → 531	Thrombospondin type 3 repeat	Repeat
  PF02412	TSP_3	555 → 590	Thrombospondin type 3 repeat	Repeat
  PF02412	TSP_3	590 → 613	Thrombospondin type 3 repeat	Repeat
  PF02412	TSP_3	614 → 651	Thrombospondin type 3 repeat	Repeat
  PF02412	TSP_3	652 → 691	Thrombospondin type 3 repeat	Repeat
  PF02412	TSP_3	692 → 727	Thrombospondin type 3 repeat	Repeat
  PF05735	TSP_C	745 → 942	Thrombospondin C-terminal region	Family

• Sequence:

  MLAPRGAAVLLLHLVLQRWLAAGAQATPQVFDLLPSSSQRLNPGALLPVLTDPALNDLYV
  ISTFKLQTKSSATIFGLYSSTDNSKYFEFTVMGRLNKAILRYLKNDGKVHLVVFNNLQLA
  DGRRHRILLRLSNLQRGAGSLELYLDCIQVDSVHNLPRAFAGPSQKPETIELRTFQRKPQ
  DFLEELKLVVRGSLFQVASLQDCFLQQSEPLAATGTGDFNRQFLGQMTQLNQLLGEVKDL
  LRQQVKETSFLRNTIAECQACGPLKFQSPTPSTVVPPAPPAPPTRPPRRCDSNPCFRGVQ
  CTDSRDGFQCGPCPEGYTGNGITCIDVDECKYHPCYPGVHCINLSPGFRCDACPVGFTGP
  MVQGVGISFAKSNKQVCTDIDECRNGACVPNSICVNTLGSYRCGPCKPGYTGDQIRGCKA
  ERNCRNPELNPCSVNAQCIEERQGDVTCVCGVGWAGDGYICGKDVDIDSYPDEELPCSAR
  NCKKDNCKYVPNSGQEDADRDGIGDACDEDADGDGILNEQDNCVLIHNVDQRNSDKDIFG
  DACDNCLSVLNNDQKDTDGDGRGDACDDDMDGDGIKNILDNCPKFPNRDQRDKDGDGVGD
  ACDSCPDVSNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKDGIG
  DECDDDDDNDGIPDLVPPGPDNCRLVPNPAQEDSNSDGVGDICESDFDQDQVIDRIDVCP
  ENAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVD
  FEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVK
  SKTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYE
  GSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFDRFD
  N

• Sequence length: 961

Pathways

KEGG:

Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cytoskeleton in muscle cells
Malaria
Human papillomavirus infection

Reactome:

Signaling by PDGF

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hirschsprung disease, susceptibility to, 1	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	21701537		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	20846368		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	34044860	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	12952849, 29545349		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	12952849, 29545349		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30616060		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20846368	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	31703077		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27769059	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36232491	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	29712757		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	32631246	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	22011848		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	30669608	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31498525		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	31498525		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	30802535		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20846368		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20846368	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	14674882		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	12482844, 14674882, 25976449		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	15121769	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	14674882		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30001809, 30669608		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	31227875		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	32111749	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31227875		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	31227875	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	31227875	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31227875		★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	29729633		★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	23801863	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	32913388	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	15131549, 29729633		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	23801863	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28177895, 30802535		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	30802535		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31703077	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	LHGDN	15897551		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30616060		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27357608		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27160021, 30355943, 30746617, 31703077		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27160021, 30746617, 30802535, 31703077		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31498525		★☆☆☆☆ Found in Text Mining only
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	39240344	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	29712757		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	12482844, 14674882, 15131549, 16923428, 29729633, 30972713		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	16099885	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	16923428		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15897551, 20846368, 27160021, 28177895, 28481870, 31703077		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	30669608	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	39213112	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	30669608		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	39213112	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	31227875	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	31227875		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	31227875		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	31703077	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27357608		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27357608, 32665998	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27160021, 30355943, 30746617, 31703077		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21701537, 31703077, 36241983	Associate	★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	29807011		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33910854	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	34309635	Associate	★☆☆☆☆ Found in Text Mining only