TSPO (translocator protein)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 706
Gene name Translocator protein
Gene symbol TSPO
Synonyms (NCBI Gene)
BPBSBZRPDBIIBPMBRPBRPBSPKBSPTBRTSPO1mDRCpk18
Chromosome 22
Chromosome location 22q13.2
Summary Present mainly in the mitochondrial compartment of peripheral tissues, the protein encoded by this gene interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholestero
miRNA miRNA information provided by mirtarbase database.
6
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (6)
miRTarBase ID miRNA Experiments Reference
MIRT2138125 hsa-miR-298 CLIP-seq
MIRT2359100 hsa-miR-1197 CLIP-seq
MIRT2138125 hsa-miR-298 CLIP-seq
MIRT2359101 hsa-miR-4436a CLIP-seq
MIRT2359102 hsa-miR-4700-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
63
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (63)
GO ID Ontology Definition Evidence Reference
GO:0005497 Function Androgen binding IEA
GO:0005515 Function Protein binding IPI 17143515, 25416956, 28514442, 31515488, 32296183, 33961781, 37047353
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IDA
GO:0005739 Component Mitochondrion IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
109610 1158 ENSG00000100300
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P30536
Protein name Translocator protein (Mitochondrial benzodiazepine receptor) (PKBS) (Peripheral-type benzodiazepine receptor) (PBR)
Protein function Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme (By similarity). Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism (PubMed:24814875), but its preci
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03073 TspO_MBR 10 → 156 TspO/MBR family Family
Tissue specificity TISSUE SPECIFICITY: Found in many tissue types. Expressed at the highest levels under normal conditions in tissues that synthesize steroids. {ECO:0000269|PubMed:20600583}.
Sequence
Sequence length 169
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
B1AH88
Protein name Putative peripheral benzodiazepine receptor-related protein
Family and domains
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence 
MAPHLLWCPTNGLGLGGSPAGQWGGGSHYRGLVPGEPAGRPPALPLPGLAGLHDHTQLLR
MAGQPWLAWGTAAARVSARPTRDCSCTSRCHHACDVVAVTLS
Sequence length 102
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Neuroactive ligand-receptor interaction
Cholesterol metabolism
Human T-cell leukemia virus 1 infection 		  Pregnenolone biosynthesis
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (3)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BIPOLAR DISORDER — Disgenet
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
HEPATIC ENCEPHALOPATHY — CTD, Disgenet
CTD, Disgenet
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL — CTD
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (282)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenoma Adenoma BEFREE 30682058
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenoma of large intestine Colorectal adenoma BEFREE 15755996, 30682058
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenomatous Polyposis Coli Multiple polyposis syndrome BEFREE 27876571
★★★★★
★☆☆☆☆
Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia T-Cell Lymphoma/Leukemia BEFREE 28004979
★★★★★
★☆☆☆☆
Found in Text Mining only
Age related macular degeneration Age-related macular degeneration BEFREE 28973423, 30477223
★★★★★
★☆☆☆☆
Found in Text Mining only
Allergic rhinitis (disorder) Allergic rhinitis BEFREE 20553297, 30851701
★★★★★
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 25840980, 26762507, 31256132, 31276244, 31536662, 32842621, 35522669, 37580767, 40187909 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 37801139 Stimulate
★★★★★
★☆☆☆☆
Found in Text Mining only
Amyloidosis Amyloidosis BEFREE 23036020, 30261283, 30262517, 31194989, 31353865
★★★★★
★☆☆☆☆
Found in Text Mining only
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis BEFREE 25807946, 31562223
★★★★★
★☆☆☆☆
Found in Text Mining only