Gene Gene information from NCBI Gene database.
Entrez ID 7056
Gene name Thrombomodulin
Gene symbol THBD
Synonyms (NCBI Gene)
AHUS6BDCA-3BDCA3CD141THPH12THRMTM
Chromosome 20
Chromosome location 20p11.21
Summary The protein encoded by this intronless gene is an endothelial-specific type I membrane receptor that binds thrombin. This binding results in the activation of protein C, which degrades clotting factors Va and VIIIa and reduces the amount of thrombin gener
SNPs SNP information provided by dbSNP.
10
SNP ID Visualize variation Clinical significance Consequence
rs1800576 C>T Conflicting-interpretations-of-pathogenicity, risk-factor, likely-benign Missense variant, coding sequence variant
rs1800578 G>A,T Risk-factor, likely-benign Missense variant, coding sequence variant
rs1800579 G>A Conflicting-interpretations-of-pathogenicity, likely-benign Missense variant, coding sequence variant
rs16984852 C>A Pathogenic 5 prime UTR variant
rs121918667 T>C Risk-factor Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
174
miRTarBase ID miRNA Experiments Reference
MIRT017044 hsa-miR-335-5p Microarray 18185580
MIRT024294 hsa-miR-215-5p Microarray 19074876
MIRT026159 hsa-miR-192-5p Microarray 19074876
MIRT636182 hsa-miR-4436b-3p HITS-CLIP 23824327
MIRT636181 hsa-miR-4632-5p HITS-CLIP 23824327
Transcription factors Transcription factors information provided by TRRUST V2 database.
14
Transcription factor Regulation Reference
EP300 Repression 15677570
KLF2 Activation 19661484
KLF4 Activation 19661484
NFKB1 Repression 17211835;22406829
PARP1 Activation 21489980
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
35
GO ID Ontology Definition Evidence Reference
GO:0004888 Function Transmembrane signaling receptor activity IEA
GO:0005509 Function Calcium ion binding IEA
GO:0005509 Function Calcium ion binding TAS 10336638
GO:0005515 Function Protein binding IPI 14691232, 17379830, 32296183
GO:0005615 Component Extracellular space IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
188040 11784 ENSG00000178726
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P07204
Protein name Thrombomodulin (TM) (Fetomodulin) (CD antigen CD141)
Protein function Endothelial cell receptor that plays a critical role in regulating several physiological processes including hemostasis, coagulation, fibrinolysis, inflammation, and angiogenesis (PubMed:10761923). Acts as a cofactor for thrombin activation of p
PDB 1ADX , 1DQB , 1DX5 , 1EGT , 1FGD , 1FGE , 1HLT , 1TMR , 1ZAQ , 2ADX , 3GIS , 5TO3 , 7T4R
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 41 169 Lectin C-type domain Domain
PF14670 FXa_inhibition 245 280 Domain
PF12662 cEGF 305 328 Complement Clr-like EGF-like Domain
Tissue specificity TISSUE SPECIFICITY: Endothelial cells are unique in synthesizing thrombomodulin.
Sequence
MLGVLVLGALALAGLGFPAPAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLM
TVRSSVAADVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYS
RWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCEF
HFPATCRPLAV
EPGAAAAAVSITYGTPFAARGADFQALPVGSSAAVAPLGLQLMCTAPPGAVQGHWAREAP
GAWDCSVENGGCEHACNAIPGAPRCQCPAGAALQADGRSCTASATQSCNDLCEHFCVPNP
DQPGSYSCMCETGYRLAADQHRCEDVDDCILEPSPCPQRCVNTQGGFECHCYPNYDLVDG
ECVEPVDPCFRANCEYQCQPLNQTSYLCVCAEGFAPIPHEPHRCQMFCNQTACPADCDPN
TQASCECPEGYILDDGFICTDIDECENGGFCSGVCHNLPGTFECICGPDSALARHIGTDC
DSGKVDGGDSGSGEPPPSPTPGSTLTPPAVGLVHSGLLIGISIASLCLVVALLALLCHLR
KKQGAARAKMEYKCAAPSKEVVLQHVRTERTPQRL
Sequence length 575
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Complement and coagulation cascades
AGE-RAGE signaling pathway in diabetic complications
Fluid shear stress and atherosclerosis
  Common Pathway of Fibrin Clot Formation
Cell surface interactions at the vascular wall
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
28
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Abnormal bleeding Likely pathogenic rs1600409143, rs1600409323 RCV000852043
RCV000851928
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Thrombocytopenia Likely pathogenic rs1600409143 RCV001270487
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Thrombomodulin-related bleeding disorder Pathogenic; Likely pathogenic rs2122673257, rs1600409143, rs1600409323 RCV000013552
RCV005864529
RCV005864527
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Abnormal thrombosis Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ASTHMA Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATYPICAL HEMOLYTIC UREMIC SYNDROME CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATYPICAL HEMOLYTIC UREMIC SYNDROME WITH COMPLEMENT GENE ABNORMALITY Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Activated Protein C Resistance Activated Protein C Resistance BEFREE 31425204
★☆☆☆☆
Found in Text Mining only
Acute Coronary Syndrome Coronary Syndrome BEFREE 15183044, 29887328
★☆☆☆☆
Found in Text Mining only
Acute Coronary Syndrome Coronary Syndrome LHGDN 15183044, 16307806
★☆☆☆☆
Found in Text Mining only
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 27605400
★☆☆☆☆
Found in Text Mining only
Acute Megakaryocytic Leukemias Megakaryocytic Leukemia BEFREE 1709310
★☆☆☆☆
Found in Text Mining only
Acute Promyelocytic Leukemia Promyelocytic Leukemia CTD_human_DG 16206674
★☆☆☆☆
Found in Text Mining only
Acute Promyelocytic Leukemia Promyelocytic Leukemia BEFREE 7878635, 7949172, 8555488, 9269772
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 11696172, 11972864
★☆☆☆☆
Found in Text Mining only
Age related macular degeneration Age-related macular degeneration BEFREE 29592796
★☆☆☆☆
Found in Text Mining only
Anemia Sickle Cell Sickle cell anemia Pubtator 22052675 Associate
★☆☆☆☆
Found in Text Mining only