Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7052
Gene name	Transglutaminase 2
Gene symbol	TGM2
Synonyms (NCBI Gene)	G(h)TG(C)TGChTG2tTG
Chromosome	20
Chromosome location	20q11.23
Summary	Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds. While the primary structure of transglutaminases is not conserved, they all have the same amino acid sequence at their active sites

552

Show/Hide all (552)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006814	hsa-miR-1285-3p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	22294552
MIRT006814	hsa-miR-1285-3p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	22294552
MIRT019710	hsa-miR-375	Microarray	20215506
MIRT020574	hsa-miR-155-5p	Proteomics	18668040
MIRT025339	hsa-miR-34a-5p	Proteomics	21566225
MIRT025649	hsa-miR-7-5p	Microarray	19073608
MIRT028406	hsa-miR-30a-5p	Proteomics	18668040
MIRT439462	hsa-miR-127-3p	HITS-CLIP	24374217
MIRT439462	hsa-miR-127-3p	HITS-CLIP	24374217
MIRT1421808	hsa-miR-1256	CLIP-seq
MIRT1421809	hsa-miR-1301	CLIP-seq
MIRT1421810	hsa-miR-1909	CLIP-seq
MIRT1421811	hsa-miR-1914	CLIP-seq
MIRT1421812	hsa-miR-198	CLIP-seq
MIRT1421813	hsa-miR-19a	CLIP-seq
MIRT1421814	hsa-miR-19b	CLIP-seq
MIRT1421815	hsa-miR-214	CLIP-seq
MIRT1421816	hsa-miR-2278	CLIP-seq
MIRT1421817	hsa-miR-3074-5p	CLIP-seq
MIRT1421818	hsa-miR-3124-3p	CLIP-seq
MIRT1421819	hsa-miR-3132	CLIP-seq
MIRT1421820	hsa-miR-3155	CLIP-seq
MIRT1421821	hsa-miR-3155b	CLIP-seq
MIRT1421822	hsa-miR-3168	CLIP-seq
MIRT1421823	hsa-miR-330-3p	CLIP-seq
MIRT1421824	hsa-miR-3619-5p	CLIP-seq
MIRT1421825	hsa-miR-4283	CLIP-seq
MIRT1421826	hsa-miR-4291	CLIP-seq
MIRT1421827	hsa-miR-4447	CLIP-seq
MIRT1421828	hsa-miR-4451	CLIP-seq
MIRT1421829	hsa-miR-4453	CLIP-seq
MIRT1421830	hsa-miR-4472	CLIP-seq
MIRT1421831	hsa-miR-4488	CLIP-seq
MIRT1421832	hsa-miR-450b-3p	CLIP-seq
MIRT1421833	hsa-miR-4538	CLIP-seq
MIRT1421834	hsa-miR-4661-5p	CLIP-seq
MIRT1421835	hsa-miR-4685-5p	CLIP-seq
MIRT1421836	hsa-miR-4697-5p	CLIP-seq
MIRT1421837	hsa-miR-4713-3p	CLIP-seq
MIRT1421838	hsa-miR-4713-5p	CLIP-seq
MIRT1421839	hsa-miR-4732-5p	CLIP-seq
MIRT1421840	hsa-miR-4761-5p	CLIP-seq
MIRT1421841	hsa-miR-484	CLIP-seq
MIRT1421842	hsa-miR-5047	CLIP-seq
MIRT1421843	hsa-miR-518a-5p	CLIP-seq
MIRT1421844	hsa-miR-527	CLIP-seq
MIRT1421845	hsa-miR-638	CLIP-seq
MIRT1421846	hsa-miR-645	CLIP-seq
MIRT1421847	hsa-miR-761	CLIP-seq
MIRT1421848	hsa-miR-769-3p	CLIP-seq
MIRT1421849	hsa-miR-922	CLIP-seq
MIRT1421850	hsa-miR-942	CLIP-seq
MIRT1421851	hsa-miR-106a	CLIP-seq
MIRT1421852	hsa-miR-106b	CLIP-seq
MIRT1421853	hsa-miR-1197	CLIP-seq
MIRT1421854	hsa-miR-142-5p	CLIP-seq
MIRT1421855	hsa-miR-17	CLIP-seq
MIRT1421856	hsa-miR-20a	CLIP-seq
MIRT1421857	hsa-miR-20b	CLIP-seq
MIRT1421858	hsa-miR-302a	CLIP-seq
MIRT1421859	hsa-miR-302b	CLIP-seq
MIRT1421860	hsa-miR-302c	CLIP-seq
MIRT1421861	hsa-miR-302d	CLIP-seq
MIRT1421862	hsa-miR-302e	CLIP-seq
MIRT1421863	hsa-miR-3117-3p	CLIP-seq
MIRT1421864	hsa-miR-3145-3p	CLIP-seq
MIRT1421865	hsa-miR-340	CLIP-seq
MIRT1421866	hsa-miR-3609	CLIP-seq
MIRT1421867	hsa-miR-372	CLIP-seq
MIRT1421868	hsa-miR-373	CLIP-seq
MIRT1421869	hsa-miR-4796-3p	CLIP-seq
MIRT1421870	hsa-miR-519d	CLIP-seq
MIRT1421871	hsa-miR-520a-3p	CLIP-seq
MIRT1421872	hsa-miR-520b	CLIP-seq
MIRT1421873	hsa-miR-520c-3p	CLIP-seq
MIRT1421874	hsa-miR-520d-3p	CLIP-seq
MIRT1421875	hsa-miR-520e	CLIP-seq
MIRT1421876	hsa-miR-520f	CLIP-seq
MIRT1421877	hsa-miR-548ah	CLIP-seq
MIRT1421878	hsa-miR-93	CLIP-seq
MIRT1557180	hsa-miR-4640-5p	CLIP-seq
MIRT1557181	hsa-miR-4726-5p	CLIP-seq
MIRT1557182	hsa-miR-492	CLIP-seq
MIRT2126533	hsa-miR-1285	CLIP-seq
MIRT2126534	hsa-miR-129-5p	CLIP-seq
MIRT2126535	hsa-miR-1324	CLIP-seq
MIRT2126536	hsa-miR-3154	CLIP-seq
MIRT2126537	hsa-miR-3161	CLIP-seq
MIRT2126538	hsa-miR-3173-5p	CLIP-seq
MIRT2126539	hsa-miR-3179	CLIP-seq
MIRT2126540	hsa-miR-3187-5p	CLIP-seq
MIRT2126541	hsa-miR-3936	CLIP-seq
MIRT2126542	hsa-miR-3945	CLIP-seq
MIRT2126543	hsa-miR-3977	CLIP-seq
MIRT2126544	hsa-miR-4253	CLIP-seq
MIRT2126545	hsa-miR-4476	CLIP-seq
MIRT2126546	hsa-miR-4484	CLIP-seq
MIRT2126547	hsa-miR-513b	CLIP-seq
MIRT1421843	hsa-miR-518a-5p	CLIP-seq
MIRT1421844	hsa-miR-527	CLIP-seq
MIRT2126548	hsa-miR-548an	CLIP-seq
MIRT2126549	hsa-miR-612	CLIP-seq
MIRT2126534	hsa-miR-129-5p	CLIP-seq
MIRT2126535	hsa-miR-1324	CLIP-seq
MIRT2348468	hsa-miR-2861	CLIP-seq
MIRT2126537	hsa-miR-3161	CLIP-seq
MIRT2348469	hsa-miR-3163	CLIP-seq
MIRT2126543	hsa-miR-3977	CLIP-seq
MIRT2126546	hsa-miR-4484	CLIP-seq
MIRT2348470	hsa-miR-4522	CLIP-seq
MIRT2348471	hsa-miR-4687-3p	CLIP-seq
MIRT2126547	hsa-miR-513b	CLIP-seq
MIRT2126548	hsa-miR-548an	CLIP-seq
MIRT2348472	hsa-miR-635	CLIP-seq
MIRT2348473	hsa-miR-767-3p	CLIP-seq
MIRT2395740	hsa-miR-1179	CLIP-seq
MIRT1421808	hsa-miR-1256	CLIP-seq
MIRT2395741	hsa-miR-128	CLIP-seq
MIRT2395742	hsa-miR-1293	CLIP-seq
MIRT2395743	hsa-miR-1294	CLIP-seq
MIRT1421809	hsa-miR-1301	CLIP-seq
MIRT2395744	hsa-miR-1343	CLIP-seq
MIRT2395745	hsa-miR-135a	CLIP-seq
MIRT2395746	hsa-miR-135b	CLIP-seq
MIRT2395747	hsa-miR-146b-3p	CLIP-seq
MIRT2395748	hsa-miR-27a	CLIP-seq
MIRT2395749	hsa-miR-27b	CLIP-seq
MIRT2348468	hsa-miR-2861	CLIP-seq
MIRT2395750	hsa-miR-3120-3p	CLIP-seq
MIRT1421819	hsa-miR-3132	CLIP-seq
MIRT2395751	hsa-miR-3147	CLIP-seq
MIRT1421820	hsa-miR-3155	CLIP-seq
MIRT1421821	hsa-miR-3155b	CLIP-seq
MIRT2126538	hsa-miR-3173-5p	CLIP-seq
MIRT2395752	hsa-miR-323-5p	CLIP-seq
MIRT2395753	hsa-miR-3612	CLIP-seq
MIRT2395754	hsa-miR-3620	CLIP-seq
MIRT2395755	hsa-miR-3940-5p	CLIP-seq
MIRT2126543	hsa-miR-3977	CLIP-seq
MIRT2395756	hsa-miR-4292	CLIP-seq
MIRT2395757	hsa-miR-4330	CLIP-seq
MIRT2395758	hsa-miR-4425	CLIP-seq
MIRT2395759	hsa-miR-4443	CLIP-seq
MIRT2395760	hsa-miR-4481	CLIP-seq
MIRT2395761	hsa-miR-4483	CLIP-seq
MIRT2395762	hsa-miR-4506	CLIP-seq
MIRT2395763	hsa-miR-4507	CLIP-seq
MIRT2395764	hsa-miR-4639-3p	CLIP-seq
MIRT2395765	hsa-miR-4667-5p	CLIP-seq
MIRT2348471	hsa-miR-4687-3p	CLIP-seq
MIRT2395766	hsa-miR-4694-3p	CLIP-seq
MIRT2395767	hsa-miR-4700-5p	CLIP-seq
MIRT2395768	hsa-miR-4710	CLIP-seq
MIRT2395769	hsa-miR-4745-5p	CLIP-seq
MIRT2395770	hsa-miR-4747-5p	CLIP-seq
MIRT2395771	hsa-miR-4758-5p	CLIP-seq
MIRT2395772	hsa-miR-4792	CLIP-seq
MIRT1421841	hsa-miR-484	CLIP-seq
MIRT1421842	hsa-miR-5047	CLIP-seq
MIRT2126547	hsa-miR-513b	CLIP-seq
MIRT2395773	hsa-miR-522	CLIP-seq
MIRT2395774	hsa-miR-545	CLIP-seq
MIRT2395775	hsa-miR-615-5p	CLIP-seq
MIRT1421846	hsa-miR-645	CLIP-seq
MIRT2395776	hsa-miR-650	CLIP-seq
MIRT2395777	hsa-miR-874	CLIP-seq
MIRT2395778	hsa-miR-885-3p	CLIP-seq
MIRT1421813	hsa-miR-19a	CLIP-seq
MIRT1421814	hsa-miR-19b	CLIP-seq
MIRT1421822	hsa-miR-3168	CLIP-seq
MIRT1421823	hsa-miR-330-3p	CLIP-seq
MIRT2433854	hsa-miR-4799-5p	CLIP-seq
MIRT1421843	hsa-miR-518a-5p	CLIP-seq
MIRT1421844	hsa-miR-527	CLIP-seq
MIRT2395740	hsa-miR-1179	CLIP-seq
MIRT2441013	hsa-miR-1207-5p	CLIP-seq
MIRT2441014	hsa-miR-1225-3p	CLIP-seq
MIRT1421808	hsa-miR-1256	CLIP-seq
MIRT2441015	hsa-miR-1273f	CLIP-seq
MIRT1421809	hsa-miR-1301	CLIP-seq
MIRT2441016	hsa-miR-143	CLIP-seq
MIRT1421810	hsa-miR-1909	CLIP-seq
MIRT2441017	hsa-miR-2355-5p	CLIP-seq
MIRT2441018	hsa-miR-24	CLIP-seq
MIRT2395750	hsa-miR-3120-3p	CLIP-seq
MIRT2441019	hsa-miR-3144-5p	CLIP-seq
MIRT2395751	hsa-miR-3147	CLIP-seq
MIRT1421820	hsa-miR-3155	CLIP-seq
MIRT1421821	hsa-miR-3155b	CLIP-seq
MIRT2441020	hsa-miR-3191	CLIP-seq
MIRT2441021	hsa-miR-3664-3p	CLIP-seq
MIRT2441022	hsa-miR-3929	CLIP-seq
MIRT2441023	hsa-miR-3943	CLIP-seq
MIRT2441024	hsa-miR-4307	CLIP-seq
MIRT2441025	hsa-miR-4419b	CLIP-seq
MIRT2395758	hsa-miR-4425	CLIP-seq
MIRT2441026	hsa-miR-4433	CLIP-seq
MIRT2441027	hsa-miR-4438	CLIP-seq
MIRT2441028	hsa-miR-4459	CLIP-seq
MIRT2441029	hsa-miR-4478	CLIP-seq
MIRT2395760	hsa-miR-4481	CLIP-seq
MIRT2441030	hsa-miR-4489	CLIP-seq
MIRT1557180	hsa-miR-4640-5p	CLIP-seq
MIRT2441031	hsa-miR-4652-5p	CLIP-seq
MIRT2348471	hsa-miR-4687-3p	CLIP-seq
MIRT2441032	hsa-miR-4688	CLIP-seq
MIRT2441033	hsa-miR-4691-5p	CLIP-seq
MIRT2441034	hsa-miR-4695-5p	CLIP-seq
MIRT2441035	hsa-miR-4708-5p	CLIP-seq
MIRT1557181	hsa-miR-4726-5p	CLIP-seq
MIRT2395769	hsa-miR-4745-5p	CLIP-seq
MIRT2395770	hsa-miR-4747-5p	CLIP-seq
MIRT2395771	hsa-miR-4758-5p	CLIP-seq
MIRT2441036	hsa-miR-4763-3p	CLIP-seq
MIRT2441037	hsa-miR-4768-3p	CLIP-seq
MIRT2441038	hsa-miR-4770	CLIP-seq
MIRT1421841	hsa-miR-484	CLIP-seq
MIRT2441039	hsa-miR-485-5p	CLIP-seq
MIRT2441040	hsa-miR-486-3p	CLIP-seq
MIRT2441041	hsa-miR-491-5p	CLIP-seq
MIRT1421842	hsa-miR-5047	CLIP-seq
MIRT2441042	hsa-miR-516a-3p	CLIP-seq
MIRT2395774	hsa-miR-545	CLIP-seq
MIRT2441043	hsa-miR-549	CLIP-seq
MIRT1421846	hsa-miR-645	CLIP-seq
MIRT2441044	hsa-miR-711	CLIP-seq
MIRT2395778	hsa-miR-885-3p	CLIP-seq
MIRT2395740	hsa-miR-1179	CLIP-seq
MIRT2441015	hsa-miR-1273f	CLIP-seq
MIRT2441016	hsa-miR-143	CLIP-seq
MIRT2395750	hsa-miR-3120-3p	CLIP-seq
MIRT2395760	hsa-miR-4481	CLIP-seq
MIRT2441035	hsa-miR-4708-5p	CLIP-seq
MIRT2395769	hsa-miR-4745-5p	CLIP-seq
MIRT2395771	hsa-miR-4758-5p	CLIP-seq
MIRT2441038	hsa-miR-4770	CLIP-seq
MIRT2395774	hsa-miR-545	CLIP-seq
MIRT2395740	hsa-miR-1179	CLIP-seq
MIRT2441013	hsa-miR-1207-5p	CLIP-seq
MIRT2441014	hsa-miR-1225-3p	CLIP-seq
MIRT2641411	hsa-miR-1252	CLIP-seq
MIRT1421808	hsa-miR-1256	CLIP-seq
MIRT2641412	hsa-miR-1263	CLIP-seq
MIRT2641413	hsa-miR-1266	CLIP-seq
MIRT2441015	hsa-miR-1273f	CLIP-seq
MIRT2641414	hsa-miR-1275	CLIP-seq
MIRT2126533	hsa-miR-1285	CLIP-seq
MIRT2395742	hsa-miR-1293	CLIP-seq
MIRT2641415	hsa-miR-129-3p	CLIP-seq
MIRT2126534	hsa-miR-129-5p	CLIP-seq
MIRT1421809	hsa-miR-1301	CLIP-seq
MIRT2126535	hsa-miR-1324	CLIP-seq
MIRT2441016	hsa-miR-143	CLIP-seq
MIRT2395747	hsa-miR-146b-3p	CLIP-seq
MIRT2641416	hsa-miR-149	CLIP-seq
MIRT1421810	hsa-miR-1909	CLIP-seq
MIRT1421811	hsa-miR-1914	CLIP-seq
MIRT1421812	hsa-miR-198	CLIP-seq
MIRT1421813	hsa-miR-19a	CLIP-seq
MIRT1421814	hsa-miR-19b	CLIP-seq
MIRT1421816	hsa-miR-2278	CLIP-seq
MIRT2441017	hsa-miR-2355-5p	CLIP-seq
MIRT2441018	hsa-miR-24	CLIP-seq
MIRT2641417	hsa-miR-3064-5p	CLIP-seq
MIRT1421817	hsa-miR-3074-5p	CLIP-seq
MIRT2395750	hsa-miR-3120-3p	CLIP-seq
MIRT1421818	hsa-miR-3124-3p	CLIP-seq
MIRT1421819	hsa-miR-3132	CLIP-seq
MIRT2641418	hsa-miR-3136-3p	CLIP-seq
MIRT2441019	hsa-miR-3144-5p	CLIP-seq
MIRT2395751	hsa-miR-3147	CLIP-seq
MIRT2126536	hsa-miR-3154	CLIP-seq
MIRT1421820	hsa-miR-3155	CLIP-seq
MIRT1421821	hsa-miR-3155b	CLIP-seq
MIRT2126537	hsa-miR-3161	CLIP-seq
MIRT1421822	hsa-miR-3168	CLIP-seq
MIRT2641419	hsa-miR-3170	CLIP-seq
MIRT2126538	hsa-miR-3173-5p	CLIP-seq
MIRT2126539	hsa-miR-3179	CLIP-seq
MIRT2641420	hsa-miR-3183	CLIP-seq
MIRT2126540	hsa-miR-3187-5p	CLIP-seq
MIRT2441020	hsa-miR-3191	CLIP-seq
MIRT1421823	hsa-miR-330-3p	CLIP-seq
MIRT1421865	hsa-miR-340	CLIP-seq
MIRT2641421	hsa-miR-342-5p	CLIP-seq
MIRT2641422	hsa-miR-3606	CLIP-seq
MIRT2641423	hsa-miR-361-3p	CLIP-seq
MIRT2395754	hsa-miR-3620	CLIP-seq
MIRT2441021	hsa-miR-3664-3p	CLIP-seq
MIRT2641424	hsa-miR-3691-3p	CLIP-seq
MIRT2641425	hsa-miR-3914	CLIP-seq
MIRT2441022	hsa-miR-3929	CLIP-seq
MIRT2126541	hsa-miR-3936	CLIP-seq
MIRT2441023	hsa-miR-3943	CLIP-seq
MIRT2126542	hsa-miR-3945	CLIP-seq
MIRT2126544	hsa-miR-4253	CLIP-seq
MIRT2641426	hsa-miR-4257	CLIP-seq
MIRT2641427	hsa-miR-4260	CLIP-seq
MIRT2395756	hsa-miR-4292	CLIP-seq
MIRT2441024	hsa-miR-4307	CLIP-seq
MIRT2641428	hsa-miR-431	CLIP-seq
MIRT2441025	hsa-miR-4419b	CLIP-seq
MIRT2395758	hsa-miR-4425	CLIP-seq
MIRT2441026	hsa-miR-4433	CLIP-seq
MIRT2641429	hsa-miR-4436a	CLIP-seq
MIRT2441027	hsa-miR-4438	CLIP-seq
MIRT1421828	hsa-miR-4451	CLIP-seq
MIRT2441028	hsa-miR-4459	CLIP-seq
MIRT2126545	hsa-miR-4476	CLIP-seq
MIRT2441029	hsa-miR-4478	CLIP-seq
MIRT2395760	hsa-miR-4481	CLIP-seq
MIRT2395761	hsa-miR-4483	CLIP-seq
MIRT2126546	hsa-miR-4484	CLIP-seq
MIRT1421831	hsa-miR-4488	CLIP-seq
MIRT2441030	hsa-miR-4489	CLIP-seq
MIRT2641430	hsa-miR-4505	CLIP-seq
MIRT2641431	hsa-miR-4518	CLIP-seq
MIRT2641432	hsa-miR-4519	CLIP-seq
MIRT2348470	hsa-miR-4522	CLIP-seq
MIRT2641433	hsa-miR-4533	CLIP-seq
MIRT1557180	hsa-miR-4640-5p	CLIP-seq
MIRT2641434	hsa-miR-4651	CLIP-seq
MIRT2441031	hsa-miR-4652-5p	CLIP-seq
MIRT2641435	hsa-miR-4664-5p	CLIP-seq
MIRT2641436	hsa-miR-4665-5p	CLIP-seq
MIRT2395765	hsa-miR-4667-5p	CLIP-seq
MIRT2641437	hsa-miR-4684-5p	CLIP-seq
MIRT1421835	hsa-miR-4685-5p	CLIP-seq
MIRT2348471	hsa-miR-4687-3p	CLIP-seq
MIRT2641438	hsa-miR-4687-5p	CLIP-seq
MIRT2441032	hsa-miR-4688	CLIP-seq
MIRT2441033	hsa-miR-4691-5p	CLIP-seq
MIRT2395766	hsa-miR-4694-3p	CLIP-seq
MIRT2441034	hsa-miR-4695-5p	CLIP-seq
MIRT1421836	hsa-miR-4697-5p	CLIP-seq
MIRT2395767	hsa-miR-4700-5p	CLIP-seq
MIRT2441035	hsa-miR-4708-5p	CLIP-seq
MIRT1421838	hsa-miR-4713-5p	CLIP-seq
MIRT2641439	hsa-miR-4723-3p	CLIP-seq
MIRT1557181	hsa-miR-4726-5p	CLIP-seq
MIRT2641440	hsa-miR-4731-5p	CLIP-seq
MIRT1421839	hsa-miR-4732-5p	CLIP-seq
MIRT2395769	hsa-miR-4745-5p	CLIP-seq
MIRT2395770	hsa-miR-4747-5p	CLIP-seq
MIRT2395771	hsa-miR-4758-5p	CLIP-seq
MIRT2441036	hsa-miR-4763-3p	CLIP-seq
MIRT2441037	hsa-miR-4768-3p	CLIP-seq
MIRT2641441	hsa-miR-4768-5p	CLIP-seq
MIRT2441038	hsa-miR-4770	CLIP-seq
MIRT2641442	hsa-miR-4794	CLIP-seq
MIRT2433854	hsa-miR-4799-5p	CLIP-seq
MIRT1421841	hsa-miR-484	CLIP-seq
MIRT2441039	hsa-miR-485-5p	CLIP-seq
MIRT2441040	hsa-miR-486-3p	CLIP-seq
MIRT2441041	hsa-miR-491-5p	CLIP-seq
MIRT1421842	hsa-miR-5047	CLIP-seq
MIRT2641443	hsa-miR-511	CLIP-seq
MIRT2641444	hsa-miR-515-5p	CLIP-seq
MIRT2441042	hsa-miR-516a-3p	CLIP-seq
MIRT1421843	hsa-miR-518a-5p	CLIP-seq
MIRT2395773	hsa-miR-522	CLIP-seq
MIRT1421844	hsa-miR-527	CLIP-seq
MIRT2395774	hsa-miR-545	CLIP-seq
MIRT2126548	hsa-miR-548an	CLIP-seq
MIRT2441043	hsa-miR-549	CLIP-seq
MIRT2641445	hsa-miR-608	CLIP-seq
MIRT2126549	hsa-miR-612	CLIP-seq
MIRT2395775	hsa-miR-615-5p	CLIP-seq
MIRT2641446	hsa-miR-619	CLIP-seq
MIRT2641447	hsa-miR-627	CLIP-seq
MIRT2641448	hsa-miR-637	CLIP-seq
MIRT1421846	hsa-miR-645	CLIP-seq
MIRT2641449	hsa-miR-647	CLIP-seq
MIRT2441044	hsa-miR-711	CLIP-seq
MIRT2641450	hsa-miR-759	CLIP-seq
MIRT2395777	hsa-miR-874	CLIP-seq
MIRT2395778	hsa-miR-885-3p	CLIP-seq
MIRT2641451	hsa-miR-921	CLIP-seq
MIRT2641452	hsa-miR-924	CLIP-seq
MIRT1421850	hsa-miR-942	CLIP-seq
MIRT2395740	hsa-miR-1179	CLIP-seq
MIRT2441013	hsa-miR-1207-5p	CLIP-seq
MIRT2441014	hsa-miR-1225-3p	CLIP-seq
MIRT2693079	hsa-miR-1229	CLIP-seq
MIRT2641411	hsa-miR-1252	CLIP-seq
MIRT1421808	hsa-miR-1256	CLIP-seq
MIRT2641412	hsa-miR-1263	CLIP-seq
MIRT2641413	hsa-miR-1266	CLIP-seq
MIRT2441015	hsa-miR-1273f	CLIP-seq
MIRT2641414	hsa-miR-1275	CLIP-seq
MIRT2126533	hsa-miR-1285	CLIP-seq
MIRT2693080	hsa-miR-1291	CLIP-seq
MIRT2395742	hsa-miR-1293	CLIP-seq
MIRT2641415	hsa-miR-129-3p	CLIP-seq
MIRT2126534	hsa-miR-129-5p	CLIP-seq
MIRT1421809	hsa-miR-1301	CLIP-seq
MIRT2693081	hsa-miR-1321	CLIP-seq
MIRT2126535	hsa-miR-1324	CLIP-seq
MIRT2441016	hsa-miR-143	CLIP-seq
MIRT2395747	hsa-miR-146b-3p	CLIP-seq
MIRT2641416	hsa-miR-149	CLIP-seq
MIRT1421810	hsa-miR-1909	CLIP-seq
MIRT1421811	hsa-miR-1914	CLIP-seq
MIRT1421812	hsa-miR-198	CLIP-seq
MIRT1421813	hsa-miR-19a	CLIP-seq
MIRT1421814	hsa-miR-19b	CLIP-seq
MIRT1421816	hsa-miR-2278	CLIP-seq
MIRT2441017	hsa-miR-2355-5p	CLIP-seq
MIRT2441018	hsa-miR-24	CLIP-seq
MIRT2693082	hsa-miR-296-5p	CLIP-seq
MIRT2641417	hsa-miR-3064-5p	CLIP-seq
MIRT1421817	hsa-miR-3074-5p	CLIP-seq
MIRT2395750	hsa-miR-3120-3p	CLIP-seq
MIRT2693083	hsa-miR-3123	CLIP-seq
MIRT1421818	hsa-miR-3124-3p	CLIP-seq
MIRT1421819	hsa-miR-3132	CLIP-seq
MIRT2641418	hsa-miR-3136-3p	CLIP-seq
MIRT2441019	hsa-miR-3144-5p	CLIP-seq
MIRT2395751	hsa-miR-3147	CLIP-seq
MIRT2126536	hsa-miR-3154	CLIP-seq
MIRT1421820	hsa-miR-3155	CLIP-seq
MIRT1421821	hsa-miR-3155b	CLIP-seq
MIRT2126537	hsa-miR-3161	CLIP-seq
MIRT1421822	hsa-miR-3168	CLIP-seq
MIRT2641419	hsa-miR-3170	CLIP-seq
MIRT2126538	hsa-miR-3173-5p	CLIP-seq
MIRT2126539	hsa-miR-3179	CLIP-seq
MIRT2641420	hsa-miR-3183	CLIP-seq
MIRT2126540	hsa-miR-3187-5p	CLIP-seq
MIRT2441020	hsa-miR-3191	CLIP-seq
MIRT2693084	hsa-miR-323b-3p	CLIP-seq
MIRT1421823	hsa-miR-330-3p	CLIP-seq
MIRT2693085	hsa-miR-331-3p	CLIP-seq
MIRT1421865	hsa-miR-340	CLIP-seq
MIRT2641421	hsa-miR-342-5p	CLIP-seq
MIRT2641422	hsa-miR-3606	CLIP-seq
MIRT2395753	hsa-miR-3612	CLIP-seq
MIRT2641423	hsa-miR-361-3p	CLIP-seq
MIRT2395754	hsa-miR-3620	CLIP-seq
MIRT2441021	hsa-miR-3664-3p	CLIP-seq
MIRT2693086	hsa-miR-3667-3p	CLIP-seq
MIRT2693087	hsa-miR-3668	CLIP-seq
MIRT2641424	hsa-miR-3691-3p	CLIP-seq
MIRT2641425	hsa-miR-3914	CLIP-seq
MIRT2693088	hsa-miR-3925-5p	CLIP-seq
MIRT2441022	hsa-miR-3929	CLIP-seq
MIRT2126541	hsa-miR-3936	CLIP-seq
MIRT2441023	hsa-miR-3943	CLIP-seq
MIRT2126542	hsa-miR-3945	CLIP-seq
MIRT2693089	hsa-miR-3976	CLIP-seq
MIRT2126544	hsa-miR-4253	CLIP-seq
MIRT2693090	hsa-miR-4254	CLIP-seq
MIRT2641426	hsa-miR-4257	CLIP-seq
MIRT2641427	hsa-miR-4260	CLIP-seq
MIRT2693091	hsa-miR-4267	CLIP-seq
MIRT2693092	hsa-miR-4286	CLIP-seq
MIRT2395756	hsa-miR-4292	CLIP-seq
MIRT2441024	hsa-miR-4307	CLIP-seq
MIRT2693093	hsa-miR-4308	CLIP-seq
MIRT2641428	hsa-miR-431	CLIP-seq
MIRT2441025	hsa-miR-4419b	CLIP-seq
MIRT2395758	hsa-miR-4425	CLIP-seq
MIRT2441026	hsa-miR-4433	CLIP-seq
MIRT2641429	hsa-miR-4436a	CLIP-seq
MIRT2441027	hsa-miR-4438	CLIP-seq
MIRT2395759	hsa-miR-4443	CLIP-seq
MIRT2693094	hsa-miR-4446-3p	CLIP-seq
MIRT1421828	hsa-miR-4451	CLIP-seq
MIRT2441028	hsa-miR-4459	CLIP-seq
MIRT2126545	hsa-miR-4476	CLIP-seq
MIRT2441029	hsa-miR-4478	CLIP-seq
MIRT2395760	hsa-miR-4481	CLIP-seq
MIRT2395761	hsa-miR-4483	CLIP-seq
MIRT2126546	hsa-miR-4484	CLIP-seq
MIRT1421831	hsa-miR-4488	CLIP-seq
MIRT2441030	hsa-miR-4489	CLIP-seq
MIRT2693095	hsa-miR-4492	CLIP-seq
MIRT2693096	hsa-miR-4498	CLIP-seq
MIRT2641430	hsa-miR-4505	CLIP-seq
MIRT2641431	hsa-miR-4518	CLIP-seq
MIRT2641432	hsa-miR-4519	CLIP-seq
MIRT2348470	hsa-miR-4522	CLIP-seq
MIRT2641433	hsa-miR-4533	CLIP-seq
MIRT1557180	hsa-miR-4640-5p	CLIP-seq
MIRT2641434	hsa-miR-4651	CLIP-seq
MIRT2441031	hsa-miR-4652-5p	CLIP-seq
MIRT2641435	hsa-miR-4664-5p	CLIP-seq
MIRT2641436	hsa-miR-4665-5p	CLIP-seq
MIRT2395765	hsa-miR-4667-5p	CLIP-seq
MIRT2693097	hsa-miR-4679	CLIP-seq
MIRT2641437	hsa-miR-4684-5p	CLIP-seq
MIRT1421835	hsa-miR-4685-5p	CLIP-seq
MIRT2348471	hsa-miR-4687-3p	CLIP-seq
MIRT2641438	hsa-miR-4687-5p	CLIP-seq
MIRT2441032	hsa-miR-4688	CLIP-seq
MIRT2693098	hsa-miR-4690-3p	CLIP-seq
MIRT2441033	hsa-miR-4691-5p	CLIP-seq
MIRT2395766	hsa-miR-4694-3p	CLIP-seq
MIRT2693099	hsa-miR-4695-3p	CLIP-seq
MIRT2441034	hsa-miR-4695-5p	CLIP-seq
MIRT1421836	hsa-miR-4697-5p	CLIP-seq
MIRT2395767	hsa-miR-4700-5p	CLIP-seq
MIRT2441035	hsa-miR-4708-5p	CLIP-seq
MIRT1421838	hsa-miR-4713-5p	CLIP-seq
MIRT2641439	hsa-miR-4723-3p	CLIP-seq
MIRT1557181	hsa-miR-4726-5p	CLIP-seq
MIRT2641440	hsa-miR-4731-5p	CLIP-seq
MIRT1421839	hsa-miR-4732-5p	CLIP-seq
MIRT2693100	hsa-miR-4739	CLIP-seq
MIRT2395769	hsa-miR-4745-5p	CLIP-seq
MIRT2395770	hsa-miR-4747-5p	CLIP-seq
MIRT2693101	hsa-miR-4756-5p	CLIP-seq
MIRT2395771	hsa-miR-4758-5p	CLIP-seq
MIRT2441036	hsa-miR-4763-3p	CLIP-seq
MIRT2441037	hsa-miR-4768-3p	CLIP-seq
MIRT2641441	hsa-miR-4768-5p	CLIP-seq
MIRT2441038	hsa-miR-4770	CLIP-seq
MIRT2641442	hsa-miR-4794	CLIP-seq
MIRT2433854	hsa-miR-4799-5p	CLIP-seq
MIRT1421841	hsa-miR-484	CLIP-seq
MIRT2441039	hsa-miR-485-5p	CLIP-seq
MIRT2441040	hsa-miR-486-3p	CLIP-seq
MIRT2441041	hsa-miR-491-5p	CLIP-seq
MIRT1421842	hsa-miR-5047	CLIP-seq
MIRT2641443	hsa-miR-511	CLIP-seq
MIRT2641444	hsa-miR-515-5p	CLIP-seq
MIRT2441042	hsa-miR-516a-3p	CLIP-seq
MIRT1421843	hsa-miR-518a-5p	CLIP-seq
MIRT2395773	hsa-miR-522	CLIP-seq
MIRT1421844	hsa-miR-527	CLIP-seq
MIRT2395774	hsa-miR-545	CLIP-seq
MIRT2126548	hsa-miR-548an	CLIP-seq
MIRT2441043	hsa-miR-549	CLIP-seq
MIRT2641445	hsa-miR-608	CLIP-seq
MIRT2126549	hsa-miR-612	CLIP-seq
MIRT2395775	hsa-miR-615-5p	CLIP-seq
MIRT2641446	hsa-miR-619	CLIP-seq
MIRT2641447	hsa-miR-627	CLIP-seq
MIRT2693102	hsa-miR-634	CLIP-seq
MIRT2641448	hsa-miR-637	CLIP-seq
MIRT1421846	hsa-miR-645	CLIP-seq
MIRT2641449	hsa-miR-647	CLIP-seq
MIRT2395776	hsa-miR-650	CLIP-seq
MIRT2693103	hsa-miR-670	CLIP-seq
MIRT2441044	hsa-miR-711	CLIP-seq
MIRT2641450	hsa-miR-759	CLIP-seq
MIRT2693104	hsa-miR-762	CLIP-seq
MIRT2395777	hsa-miR-874	CLIP-seq
MIRT2395778	hsa-miR-885-3p	CLIP-seq
MIRT2641451	hsa-miR-921	CLIP-seq
MIRT2641452	hsa-miR-924	CLIP-seq
MIRT1421850	hsa-miR-942	CLIP-seq

Show/Hide all (80)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000785	Component	Chromatin	IDA	9575137
GO:0000786	Component	Nucleosome	IDA	30867594, 32273471
GO:0003810	Function	Protein-glutamine gamma-glutamyltransferase activity	IBA
GO:0003810	Function	Protein-glutamine gamma-glutamyltransferase activity	IDA	7649299, 9252372, 12506096, 23941696
GO:0003810	Function	Protein-glutamine gamma-glutamyltransferase activity	IEA
GO:0003810	Function	Protein-glutamine gamma-glutamyltransferase activity	IMP	7592956, 8943303, 24349085
GO:0003810	Function	Protein-glutamine gamma-glutamyltransferase activity	ISS
GO:0005509	Function	Calcium ion binding	IDA	23941696
GO:0005515	Function	Protein binding	IPI	9442029, 16301118, 16951195, 19542224, 19738201, 20080707, 21625219, 22442151, 28106549, 30082873, 32814053, 33961781
GO:0005525	Function	GTP binding	IDA	7649299
GO:0005525	Function	GTP binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IDA	9575137
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	24349085
GO:0005739	Component	Mitochondrion	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IDA	9575137, 24349085
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IDA	2578891
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	8105889
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IBA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IMP	7592956, 8943303
GO:0008233	Function	Peptidase activity	IEA
GO:0010467	Process	Gene expression	IDA	30867594
GO:0014046	Process	Dopamine secretion	IDA	32273471
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0018149	Process	Peptide cross-linking	IDA	9252372, 12506096, 23941696, 30458214
GO:0018277	Process	Protein deamination	IDA	9623982, 20547769
GO:0031012	Component	Extracellular matrix	HDA	28327460
GO:0031012	Component	Extracellular matrix	HDA	23979707, 25037231, 28675934
GO:0031012	Component	Extracellular matrix	IDA	12506096, 28198360
GO:0032471	Process	Negative regulation of endoplasmic reticulum calcium ion concentration	IEA
GO:0032471	Process	Negative regulation of endoplasmic reticulum calcium ion concentration	IMP	24349085
GO:0042981	Process	Regulation of apoptotic process	IDA	9252372
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	17116873
GO:0043065	Process	Positive regulation of apoptotic process	IMP	24349085
GO:0043277	Process	Apoptotic cell clearance	IDA	19628791
GO:0043547	Process	Positive regulation of GTPase activity	ISS
GO:0045785	Process	Positive regulation of cell adhesion	IEA
GO:0045785	Process	Positive regulation of cell adhesion	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	17116873
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050568	Function	Protein-glutamine glutaminase activity	IDA	9623982, 20547769
GO:0050568	Function	Protein-glutamine glutaminase activity	IEA
GO:0050769	Process	Positive regulation of neurogenesis	IDA	30867594
GO:0051057	Process	Positive regulation of small GTPase mediated signal transduction	ISS
GO:0051260	Process	Protein homooligomerization	IDA	17116873
GO:0051561	Process	Positive regulation of mitochondrial calcium ion concentration	IEA
GO:0051561	Process	Positive regulation of mitochondrial calcium ion concentration	IMP	24349085
GO:0060348	Process	Bone development	ISS
GO:0060445	Process	Branching involved in salivary gland morphogenesis	IEA
GO:0060662	Process	Salivary gland cavitation	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0071314	Process	Cellular response to cocaine	IDA	32273471
GO:0120294	Function	Peptide serotonyltransferase activity	IEA
GO:0120295	Function	Histone serotonyltransferase activity	IDA	30867594
GO:0120296	Function	Peptide dopaminyltransferase activity	IEA
GO:0120297	Function	Histone dopaminyltransferase activity	IDA	32273471
GO:0120298	Function	Peptide noradrenalinyltransferase activity	IEA
GO:0120299	Function	Peptide histaminyltransferase activity	IDA	23797785
GO:0120299	Function	Peptide histaminyltransferase activity	IEA
GO:1903351	Process	Cellular response to dopamine	IDA	32273471
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IDA	28198360
GO:1904015	Process	Cellular response to serotonin	IDA	30867594
GO:2000425	Process	Regulation of apoptotic cell clearance	IDA	7935379
GO:2000425	Process	Regulation of apoptotic cell clearance	IEA

MIM	HGNC	e!Ensembl
190196	11778	ENSG00000198959

P21980

Protein name

Protein-glutamine gamma-glutamyltransferase 2 (EC 2.3.2.13) (Erythrocyte transglutaminase) (Heart G alpha(h)) (hhG alpha(h)) (Isopeptidase TGM2) (EC 3.4.-.-) (Protein G alpha(h)) (G(h)) (Protein-glutamine deamidase TGM2) (EC 3.5.1.44) (Protein-glutamine d

Protein function

Calcium-dependent acyltransferase that catalyzes the formation of covalent bonds between peptide-bound glutamine and various primary amines, such as gamma-amino group of peptide-bound lysine, or mono- and polyamines, thereby producing cross-link

PDB

1KV3 , 2Q3Z , 3LY6 , 3S3J , 3S3P , 3S3S , 4PYG , 6A8P , 6KZB , 8TR9 , 9BC2 , 9BC3 , 9BC4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00868	Transglut_N	4 → 122	Transglutaminase family	Domain
PF01841	Transglut_core	255 → 359	Transglutaminase-like superfamily	Family
PF00927	Transglut_C	473 → 573	Transglutaminase family, C-terminal ig like domain	Domain
PF00927	Transglut_C	587 → 686	Transglutaminase family, C-terminal ig like domain	Domain

Sequence

MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFS
VVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE
ASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPW
NFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVHKSINRSL
IVGLKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVG
QSMNMGSDFDVFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKYLLNLNLEPFSEK
SVPLCILYEKYRDCLTESNLIKVRALLVEPVINSYLLAERDLYLENPEIKIRILGEPKQK
RKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLPLHMG
LHKLVVNFESDKLKAVKGFRNVIIGPA

Sequence length

687

Interactions

View interactions

	KEGG
	Huntington disease

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (18)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC ARRHYTHMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog, GenCC GWAS catalog, GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (325)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	11755920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	1358880, 23817628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	30149525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	20739659, 30237268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15610449, 23853482, 24828664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17440814, 18381937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	25934693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	10918174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	9712408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	7943181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	14631123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	10521460, 11013236, 22009441	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	40401986	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	39675431	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	24032595, 25867286, 29187283, 8907321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	29112123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	27548338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	27035377, 28169443, 30945642, 31326291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angioedemas, Hereditary	Angioedema	BEFREE	9519866		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	17440814, 18413840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10826705, 18923241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	31181327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Reactive	Reactive arthritis	Pubtator	9575137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	20527084	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20052409, 28810589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	20052409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	30715101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	10826705, 18923241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophy of kidney	Atrophy Of Kidney	BEFREE	31297350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30647729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11289476, 11529912, 14600421, 22198767, 22554526, 23454274, 26886924, 27840181, 29050994, 29052687, 29422338, 31181327, 31547042, 31560892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	22385244, 23454274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	28249640	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	24828664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	24828664	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	28397343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign neoplasm of brain, unspecified	Brain Neoplasms	CTD_human_DG	16170020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	21320252, 22389694		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	22389694		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	22389694	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bone neoplasms	Bone neoplasms	BEFREE	30949413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	CTD_human_DG	16170020		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	BEFREE	20596752		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain neoplasms	Pubtator	20596752	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Tumor, Primary	Brain Neoplasms	CTD_human_DG	16170020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11484985, 16449978, 16818508, 17043648, 18174247, 18497756, 18611262, 19273176, 19273216, 20080707, 20423989, 20596752, 21967801, 22399187, 23224146 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	19579870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19273176, 19273216, 20080707, 20596752, 38604527	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	24058567, 30401717	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	22958044, 29935061		★★★★★ ★☆☆☆☆ Found in Text Mining only
C-cell hyperplasia of thyroid	Thyroid Hyperplasia	BEFREE	11939755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19403524, 20080707, 37308486	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11940046, 16826431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	24058567	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	24058567	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26633708, 32792856, 37308486	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	9496255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10190315, 16891396, 20450916, 23290789, 28715877, 29301592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	18667446	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	32899691	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	16707423, 22294552, 28498731, 32560270, 33828127	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21943122, 23765377, 25934691, 2897254, 34004031	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	16826431, 19324884, 19763620, 19951993, 21963846, 23640056, 23730209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	11589716, 12909075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	12909075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	12386092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	14551530	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	12386092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	10028022, 10441179, 10672836, 10700238, 10837052, 11238668, 11529912, 11742196, 11772038, 11774946, 11843051, 12578508, 12658037, 12699968, 14592529 View all (150 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	LHGDN	12093810, 15746535, 16285941, 18312620		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	Pubtator	12392549, 19098862, 19401430, 20553859, 21056914, 21709955, 21760890, 22136669, 22366952, 23180946, 23234559, 23981538, 23982754, 24517104, 24732864 View all (26 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	CTD_human_DG	17190764		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	Pubtator	21119542, 24130874, 28250436, 31082869, 31408136	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	BEFREE	18375543, 22198379, 29570839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	29757003, 8957064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	23180946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	28711023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Class III malocclusion	Malocclusion	BEFREE	20739701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	36655602	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	27620315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20033322, 24085483, 25934693, 29374703, 31010374, 31117256, 31173203, 31360304, 31570702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18776587, 25934693, 28223538, 31173203, 31570702, 37535601, 39389321	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29481819, 29795262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	22294552, 23704086, 24610445, 27031960, 28498731, 28844802, 30105541, 30231606, 30463244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28756971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28756971, 29660517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28756971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	36655602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing's symphalangism	Proximal symphalangism	Pubtator	11159525	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	18490773, 27234323, 28982193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	20711182, 28982193, 31321000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	18523305, 26188189, 27357308, 27510997, 29145839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	CTD_human_DG	18784066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	29072680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Herpetiformis	Dermatitis herpetiformis	Pubtator	16575390, 16935926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	29072680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	14631123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	LHGDN	14631123, 15752564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17939176, 20056952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17939176, 20056952		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	30321187	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	19401430, 27543737	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36824360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10441179, 11289476, 21270278, 21317917, 21515839, 21780895, 21832836, 21911598, 27543737, 27847281, 28188747, 28745034, 29052687, 29350070, 30444426, 30952617 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12205028, 17939176, 30471182		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	12205028		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29636780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorders of Sex Development	Disorders of sex development	Pubtator	30237268, 33422029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	27260508, 27847281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	25240629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31035965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	33872388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Dystrophica	Dystrophic epidermolysis bullosa	Pubtator	24732400	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	19324884, 19951993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	17068819		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	18385788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	21567402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	12651621, 29321784, 30415489, 31200771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	25168903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	29757003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	30541347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	18825674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Glioblastoma	Giant Cell Glioblastoma	CTD_human_DG	16170020, 17099729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	28711023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	16936095, 21722634, 29535003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	16936095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	CTD_human_DG	16170020, 17099729		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	BEFREE	23770238, 23877317, 27591334, 28754668		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	Pubtator	23770238, 27591334, 37441590	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma Multiforme	Glioblastoma	BEFREE	11083075, 23770238, 23877317, 27591334, 28754668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	CTD_human_DG	16170020, 17099729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	20596752, 23877317, 27633721, 28423611, 28754668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	20596752, 28423611	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	19013523, 29382685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gluten intolerance	Gluten intolerance	BEFREE	18825674, 28168522, 28886934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	17526951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hallopeau-Siemens Disease	DYSTROPHIC EPIDERMOLYSIS BULLOSA	BEFREE	24732400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	24222955, 25131137, 28600290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29481819, 29795262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	31648987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	10037459, 10748319, 11032884, 11442349, 14985437, 15033177, 15715085, 16341586, 18417122, 20665636, 20730854, 21355047, 22698685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	10537061	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	11032884, 14985437, 36902304, 9575137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	LHGDN	12528814, 15715085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30020832, 31374233, 31830262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	31830262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	CTD_human_DG	17898543		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	28338973, 28775095, 30715101		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoglycemia	Hypoglycemia	BEFREE	12205028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23122428, 28151477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	14631123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29633623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29053339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	33474654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IgA Deficiency	Selective immunoglobulin a deficiency	Pubtator	14570724	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IgA Deficiency	Selective immunoglobulin a deficiency	Pubtator	24524552	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunoglobulin A deficiency (disorder)	Immunoglobulin A deficiency	BEFREE	26538207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inclusion Body Myopathy, Sporadic	Inclusion body myopathy	BEFREE	14631123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	18776587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	29072680		★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	18835948, 27173406, 29654212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	21056914, 24909383, 26244572, 27263022, 28112686, 29570977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	22366952	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31703587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	30265401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	24732864, 39983822	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	26568304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	29272308	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	33828127	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laron Syndrome	Laron Syndrome	BEFREE	17462934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	22458929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	23576428, 30237268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoid	Lymphoid leukemia	Pubtator	19098862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23576428	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	20739659, 30237268, 33422029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21214951, 24867713, 28339069, 28943101, 30338220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	18295389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	23180946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	17657817	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	12401132, 16891396, 20450916, 21525012, 23122428, 28002389, 28715877, 29301592	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	32678854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	30952617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	26700650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	26700650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	BEFREE	28624578, 28797308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	22294726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	30349644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	CTD_human_DG	16170020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11484985, 16449978, 16818508, 17043648, 18174247, 18497756, 18611262, 19273176, 19273216, 20080707, 20423989, 20596752, 21967801, 22399187, 23224146 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	19579870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31035965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	17068819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	29757003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	26568304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10190315, 16891396, 20450916, 23290789, 28715877, 29301592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	16826431, 19324884, 19763620, 21963846, 23640056, 23730209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17374730, 18413840, 20224296, 24725450, 26041746, 27792935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	30108682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10569613, 11956481, 16301118, 22460364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	29072680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26771235, 29785022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10569613, 10826705, 11484985, 17662645, 19403524, 20007697, 20224296, 20599779, 21036738, 21625219, 21896482, 21908620, 21963846, 22089883, 22225906 View all (33 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	27620315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	19579870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11484985, 16826431, 18174247, 19273176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15272014, 15585642, 16449978, 17043648, 18174247, 18804908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	19579870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	19579870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	22294726, 28056186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Maturity onset diabetes mellitus in young	Mason type diabetes	BEFREE	12205028, 17939176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meckel syndrome type 1	Meckel Syndrome	BEFREE	28754668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	11939755, 7889627		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	16818508		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	17314516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	18587533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	25247996, 28843270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	25247996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	21320252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	30349644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	28151477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	16818508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microspherocytosis	Microspherocytosis	BEFREE	8547071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	11032884	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	28199195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	28676444, 32553686	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 2a	Multiple Endocrine Neoplasia	BEFREE	7889627, 8783101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	21385364, 26133787, 29268771, 29282083, 29689097, 30352019, 30543718, 31058279, 31312122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	29268771, 33906937	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	14631123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Oculopharyngeal	Oculopharyngeal Muscular Dystrophy	BEFREE	20519718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	LHGDN	15556610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	18690648, 29069780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29795262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	14631123, 16967485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	10722712	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	29350070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	27554815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	36361742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11295075, 14739494, 16757564, 18174247, 18413840, 19951993, 20596752, 20599779, 21625219, 21967801, 22696263, 23640056, 23704086, 23877317, 24085483 View all (24 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	CTD_human_DG	16170020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrogenic Fibrosing Dermopathy	Nephrogenic Fibrosing Dermopathy	LHGDN	17890909		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	18825674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10527931, 11032884, 11166134, 11442349, 12065637, 15460447, 16720350, 17611083, 20007697, 22459762, 24725450, 28065858, 31469375, 7935379, 9973324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	20007697, 7935379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	10521460, 22385244, 24481335, 30321187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	10748319, 12065619, 15033177, 16539654, 18375543, 18417122, 21355047, 25398223, 26886924, 26893378, 27761757, 27837727, 28199195, 29179065, 29187283, 9587422 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	21056914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19763620, 23853482, 28715877, 30197536, 31497352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	22450891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nuclear cataract	Cataract	BEFREE	12386092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	BEFREE	29222550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	LHGDN	19278990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	29145839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthrosis Deformans	Osteoarthrosis Deformans	CTD_human_DG	18784066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28387755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	27357308, 30945642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	30967152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30015899, 30323968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	30015899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16826431, 19324884, 19763620, 19951993, 21963846, 23640056, 23730209		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18667446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18667446, 19324884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	17374730, 18413840, 24725450, 26041746, 27792935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	18413840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	17374730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	27792935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	30108682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	17374730, 25215932	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	18505736, 30195017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	19164286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	27792935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	30647729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	7943181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	14631123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	LHGDN	14631123, 15752564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precocious pubarche	Precocious Pubarche	BEFREE	12050213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	31704844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	12560760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary malignant neoplasm of brain	Brain Neoplasms	CTD_human_DG	16170020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	12578227, 15715085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	10426588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	12506096, 28781956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10569613, 11956481, 16301118, 22460364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37160910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	21989138, 28150335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	27084846	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	24175906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent Brain Neoplasm	Brain Neoplasms	CTD_human_DG	16170020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	17611083, 23817628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	26568304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16707423, 22294552, 23704086, 24610445, 27031960, 28498731, 28844802, 30105541, 30231606, 30463244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	27837727, 29352658, 29570977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	22958044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	22958044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17611083, 23817628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rickets	Rickets	BEFREE	27760369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18561261, 20926141, 26307914		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	18561261, 20926141		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin lesion	Skin Lesion	BEFREE	28150335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	25541696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	21989450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 1	Spinocerebellar Ataxia	BEFREE	17045396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxias	Spinocerebellar ataxia	Pubtator	9575137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10910994, 25934691, 28676444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28676444, 37963518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stage IV Skin Melanoma	Skin Melanoma	BEFREE	22782215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	23641075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26771235, 29785022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29785022, 32467608, 36353796	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	29145839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Feminization	Testicular Feminization	BEFREE	20493947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	32167697	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transposition of Great Vessels	Transposition Of Great Vessels	BEFREE	12050213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	15753534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	40247728	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	27760369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	21625219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Xanthinuria, Type I	Xanthinuria	BEFREE	11379872		★★★★★ ★☆☆☆☆ Found in Text Mining only

TGM2 (transglutaminase 2)