Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	7049
Gene name	Transforming growth factor beta receptor 3
Gene symbol	TGFBR3
Synonyms (NCBI Gene)	BGCANbetaglycan
Chromosome	1
Chromosome location	1p22.1
Summary	This locus encodes the transforming growth factor (TGF)-beta type III receptor. The encoded receptor is a membrane proteoglycan that often functions as a co-receptor with other TGF-beta receptor superfamily members. Ectodomain shedding produces soluble TG

465

Show/Hide all (465)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005330	hsa-miR-21-5p	Luciferase reporter assayqRT-PCR	18829576
MIRT016418	hsa-miR-193b-3p	Microarray	20304954
MIRT025118	hsa-miR-181a-5p	Sequencing	20371350
MIRT027244	hsa-miR-101-3p	Sequencing	20371350
MIRT005330	hsa-miR-21-5p	Microarray	19253296
MIRT621845	hsa-miR-3183	HITS-CLIP	23824327
MIRT621844	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT621843	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT292290	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT292287	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT621842	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT621841	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT621840	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT621839	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT292289	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT621837	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT621836	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT621845	hsa-miR-3183	HITS-CLIP	23824327
MIRT621844	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT621843	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT292290	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT292287	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT621842	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT621841	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT621840	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT621839	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT292289	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT621838	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT621837	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT621836	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT565403	hsa-miR-107	PAR-CLIP	20371350
MIRT565402	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT565401	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT565400	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT565399	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT565398	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT565397	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT565396	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT565395	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT565394	hsa-miR-330-3p	PAR-CLIP	20371350
MIRT565393	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT565392	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT565390	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT565391	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT565389	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT565388	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT565387	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT565386	hsa-miR-4310	PAR-CLIP	20371350
MIRT565385	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT565384	hsa-miR-3690	PAR-CLIP	20371350
MIRT565383	hsa-miR-4638-3p	PAR-CLIP	20371350
MIRT027244	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT027244	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT546337	hsa-miR-196b-5p	PAR-CLIP	21572407
MIRT546336	hsa-miR-196a-5p	PAR-CLIP	21572407
MIRT546335	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT546334	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT546333	hsa-miR-4458	PAR-CLIP	21572407
MIRT546332	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT546331	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT546330	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT546329	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT546328	hsa-miR-4500	PAR-CLIP	21572407
MIRT546327	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT546326	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT546325	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT546324	hsa-miR-144-3p	PAR-CLIP	21572407
MIRT546323	hsa-miR-6715a-3p	PAR-CLIP	21572407
MIRT546322	hsa-miR-202-3p	PAR-CLIP	21572407
MIRT546321	hsa-miR-582-5p	PAR-CLIP	21572407
MIRT466404	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT466403	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT466402	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT466401	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT466400	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT466399	hsa-miR-186-5p	PAR-CLIP	23592263
MIRT466398	hsa-miR-369-5p	PAR-CLIP	23592263
MIRT466397	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT439467	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439466	hsa-miR-382-3p	HITS-CLIP	24374217
MIRT439465	hsa-miR-136-3p	HITS-CLIP	24374217
MIRT439463	hsa-miR-541-5p	HITS-CLIP	24374217
MIRT439467	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439466	hsa-miR-382-3p	HITS-CLIP	24374217
MIRT439465	hsa-miR-136-3p	HITS-CLIP	24374217
MIRT439463	hsa-miR-541-5p	HITS-CLIP	24374217
MIRT565401	hsa-miR-424-5p	Luciferase reporter assayNext Generation Sequencing (NGS)qRT-PCRWestern blot	25716682
MIRT546325	hsa-let-7a-5p	qRT-PCRWestern blot	27223264
MIRT565403	hsa-miR-107	Luciferase reporter assayqRT-PCRWestern blotting	34010341
MIRT565394	hsa-miR-330-3p	qRT-PCR	32922436
MIRT621845	hsa-miR-3183	HITS-CLIP	23824327
MIRT621844	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT621843	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT292290	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT292287	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT621842	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT621841	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT621840	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT621839	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT292289	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT621837	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT621836	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT621845	hsa-miR-3183	HITS-CLIP	23824327
MIRT621844	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT621843	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT292290	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT292287	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT621842	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT621841	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT621840	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT621839	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT292289	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT621838	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT621837	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT621836	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT565403	hsa-miR-107	PAR-CLIP	20371350
MIRT565402	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT565401	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT565400	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT565399	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT565398	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT565397	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT565396	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT565395	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT565394	hsa-miR-330-3p	PAR-CLIP	20371350
MIRT565393	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT565392	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT565390	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT565391	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT565389	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT565388	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT565387	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT565386	hsa-miR-4310	PAR-CLIP	20371350
MIRT565385	hsa-miR-7157-5p	PAR-CLIP	20371350
MIRT565384	hsa-miR-3690	PAR-CLIP	20371350
MIRT565383	hsa-miR-4638-3p	PAR-CLIP	20371350
MIRT027244	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT027244	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT546337	hsa-miR-196b-5p	PAR-CLIP	21572407
MIRT546336	hsa-miR-196a-5p	PAR-CLIP	21572407
MIRT546335	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT546334	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT546333	hsa-miR-4458	PAR-CLIP	21572407
MIRT546332	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT546331	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT546330	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT546329	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT546328	hsa-miR-4500	PAR-CLIP	21572407
MIRT546327	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT546326	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT546325	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT546324	hsa-miR-144-3p	PAR-CLIP	21572407
MIRT546323	hsa-miR-6715a-3p	PAR-CLIP	21572407
MIRT546322	hsa-miR-202-3p	PAR-CLIP	21572407
MIRT546321	hsa-miR-582-5p	PAR-CLIP	21572407
MIRT466404	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT466403	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT466402	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT466401	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT466400	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT466399	hsa-miR-186-5p	PAR-CLIP	23592263
MIRT466398	hsa-miR-369-5p	PAR-CLIP	23592263
MIRT466397	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT565398	hsa-miR-15b-5p	qRT-PCR	36672009
MIRT755602	miR-17-92	Luciferase reporter assayqRT-PCR	36461008
MIRT1421504	hsa-miR-1207-3p	CLIP-seq
MIRT1421505	hsa-miR-1227	CLIP-seq
MIRT1421506	hsa-miR-1237	CLIP-seq
MIRT1421507	hsa-miR-125a-3p	CLIP-seq
MIRT1421508	hsa-miR-128	CLIP-seq
MIRT1421509	hsa-miR-1305	CLIP-seq
MIRT1421510	hsa-miR-186	CLIP-seq
MIRT1421511	hsa-miR-1915	CLIP-seq
MIRT1421512	hsa-miR-194	CLIP-seq
MIRT1421513	hsa-miR-202	CLIP-seq
MIRT1421514	hsa-miR-21	CLIP-seq
MIRT1421515	hsa-miR-23a	CLIP-seq
MIRT1421516	hsa-miR-23b	CLIP-seq
MIRT1421517	hsa-miR-23c	CLIP-seq
MIRT1421518	hsa-miR-27a	CLIP-seq
MIRT1421519	hsa-miR-27b	CLIP-seq
MIRT1421520	hsa-miR-30a	CLIP-seq
MIRT1421521	hsa-miR-30b	CLIP-seq
MIRT1421522	hsa-miR-30c	CLIP-seq
MIRT1421523	hsa-miR-30d	CLIP-seq
MIRT1421524	hsa-miR-30e	CLIP-seq
MIRT1421525	hsa-miR-3136-3p	CLIP-seq
MIRT1421526	hsa-miR-3173-3p	CLIP-seq
MIRT1421527	hsa-miR-3182	CLIP-seq
MIRT1421528	hsa-miR-328	CLIP-seq
MIRT1421529	hsa-miR-34c-3p	CLIP-seq
MIRT1421530	hsa-miR-3591-3p	CLIP-seq
MIRT1421531	hsa-miR-3674	CLIP-seq
MIRT1421532	hsa-miR-4279	CLIP-seq
MIRT1421533	hsa-miR-4420	CLIP-seq
MIRT1421534	hsa-miR-4422	CLIP-seq
MIRT1421535	hsa-miR-4423-3p	CLIP-seq
MIRT1421536	hsa-miR-4490	CLIP-seq
MIRT1421537	hsa-miR-455-5p	CLIP-seq
MIRT1421538	hsa-miR-4652-3p	CLIP-seq
MIRT1421539	hsa-miR-4685-5p	CLIP-seq
MIRT1421540	hsa-miR-4714-5p	CLIP-seq
MIRT1421541	hsa-miR-4717-3p	CLIP-seq
MIRT1421542	hsa-miR-4719	CLIP-seq
MIRT1421543	hsa-miR-4731-3p	CLIP-seq
MIRT1421544	hsa-miR-4755-3p	CLIP-seq
MIRT1421545	hsa-miR-4797-5p	CLIP-seq
MIRT1421546	hsa-miR-4801	CLIP-seq
MIRT1421547	hsa-miR-518a-3p	CLIP-seq
MIRT1421548	hsa-miR-518b	CLIP-seq
MIRT1421549	hsa-miR-518c	CLIP-seq
MIRT1421550	hsa-miR-518d-3p	CLIP-seq
MIRT1421551	hsa-miR-518f	CLIP-seq
MIRT1421552	hsa-miR-570	CLIP-seq
MIRT1421553	hsa-miR-590-5p	CLIP-seq
MIRT1421554	hsa-miR-607	CLIP-seq
MIRT1421555	hsa-miR-618	CLIP-seq
MIRT1421556	hsa-miR-656	CLIP-seq
MIRT1421557	hsa-miR-802	CLIP-seq
MIRT1421558	hsa-miR-891b	CLIP-seq
MIRT2126428	hsa-miR-1290	CLIP-seq
MIRT2126429	hsa-miR-139-5p	CLIP-seq
MIRT2126430	hsa-miR-193b	CLIP-seq
MIRT2126431	hsa-miR-376a	CLIP-seq
MIRT2126432	hsa-miR-376b	CLIP-seq
MIRT1421532	hsa-miR-4279	CLIP-seq
MIRT2126433	hsa-miR-488	CLIP-seq
MIRT2126434	hsa-miR-548v	CLIP-seq
MIRT2126435	hsa-miR-659	CLIP-seq
MIRT1421532	hsa-miR-4279	CLIP-seq
MIRT2348462	hsa-miR-548u	CLIP-seq
MIRT2126428	hsa-miR-1290	CLIP-seq
MIRT2126429	hsa-miR-139-5p	CLIP-seq
MIRT1421510	hsa-miR-186	CLIP-seq
MIRT2126430	hsa-miR-193b	CLIP-seq
MIRT2395732	hsa-miR-221	CLIP-seq
MIRT2395733	hsa-miR-222	CLIP-seq
MIRT1421532	hsa-miR-4279	CLIP-seq
MIRT2395734	hsa-miR-4776-3p	CLIP-seq
MIRT2126434	hsa-miR-548v	CLIP-seq
MIRT2395735	hsa-miR-642b	CLIP-seq
MIRT2126435	hsa-miR-659	CLIP-seq
MIRT1421508	hsa-miR-128	CLIP-seq
MIRT2433833	hsa-miR-181a	CLIP-seq
MIRT2433834	hsa-miR-181b	CLIP-seq
MIRT2433835	hsa-miR-181c	CLIP-seq
MIRT2433836	hsa-miR-181d	CLIP-seq
MIRT1421510	hsa-miR-186	CLIP-seq
MIRT1421518	hsa-miR-27a	CLIP-seq
MIRT1421519	hsa-miR-27b	CLIP-seq
MIRT2433837	hsa-miR-3065-5p	CLIP-seq
MIRT2433838	hsa-miR-3169	CLIP-seq
MIRT2433839	hsa-miR-3194-3p	CLIP-seq
MIRT2433840	hsa-miR-3198	CLIP-seq
MIRT2433841	hsa-miR-4260	CLIP-seq
MIRT2433842	hsa-miR-4262	CLIP-seq
MIRT2433843	hsa-miR-4309	CLIP-seq
MIRT2433844	hsa-miR-4312	CLIP-seq
MIRT2433845	hsa-miR-432	CLIP-seq
MIRT1421535	hsa-miR-4423-3p	CLIP-seq
MIRT2433846	hsa-miR-4653-3p	CLIP-seq
MIRT2433847	hsa-miR-4698	CLIP-seq
MIRT2433848	hsa-miR-4740-5p	CLIP-seq
MIRT2433849	hsa-miR-4789-5p	CLIP-seq
MIRT2433850	hsa-miR-4802-5p	CLIP-seq
MIRT2433851	hsa-miR-486-3p	CLIP-seq
MIRT2433852	hsa-miR-494	CLIP-seq
MIRT2433853	hsa-miR-513a-3p	CLIP-seq
MIRT1421547	hsa-miR-518a-3p	CLIP-seq
MIRT1421548	hsa-miR-518b	CLIP-seq
MIRT1421549	hsa-miR-518c	CLIP-seq
MIRT1421550	hsa-miR-518d-3p	CLIP-seq
MIRT1421551	hsa-miR-518f	CLIP-seq
MIRT2395735	hsa-miR-642b	CLIP-seq
MIRT2126428	hsa-miR-1290	CLIP-seq
MIRT2433837	hsa-miR-3065-5p	CLIP-seq
MIRT2126428	hsa-miR-1290	CLIP-seq
MIRT1421506	hsa-miR-1237	CLIP-seq
MIRT2641292	hsa-miR-1238	CLIP-seq
MIRT2641293	hsa-miR-1246	CLIP-seq
MIRT2641294	hsa-miR-1272	CLIP-seq
MIRT2126428	hsa-miR-1290	CLIP-seq
MIRT2641295	hsa-miR-129-5p	CLIP-seq
MIRT2126429	hsa-miR-139-5p	CLIP-seq
MIRT1421510	hsa-miR-186	CLIP-seq
MIRT2126430	hsa-miR-193b	CLIP-seq
MIRT2395732	hsa-miR-221	CLIP-seq
MIRT2395733	hsa-miR-222	CLIP-seq
MIRT1421515	hsa-miR-23a	CLIP-seq
MIRT1421516	hsa-miR-23b	CLIP-seq
MIRT1421517	hsa-miR-23c	CLIP-seq
MIRT2433837	hsa-miR-3065-5p	CLIP-seq
MIRT2641296	hsa-miR-3117-5p	CLIP-seq
MIRT2641297	hsa-miR-3148	CLIP-seq
MIRT2641298	hsa-miR-3167	CLIP-seq
MIRT1421527	hsa-miR-3182	CLIP-seq
MIRT2433840	hsa-miR-3198	CLIP-seq
MIRT2641299	hsa-miR-3622b-5p	CLIP-seq
MIRT2641300	hsa-miR-3663-3p	CLIP-seq
MIRT2126431	hsa-miR-376a	CLIP-seq
MIRT2126432	hsa-miR-376b	CLIP-seq
MIRT2641301	hsa-miR-382	CLIP-seq
MIRT2641302	hsa-miR-3942-3p	CLIP-seq
MIRT2433841	hsa-miR-4260	CLIP-seq
MIRT2641303	hsa-miR-4291	CLIP-seq
MIRT2641304	hsa-miR-4301	CLIP-seq
MIRT2433843	hsa-miR-4309	CLIP-seq
MIRT2433844	hsa-miR-4312	CLIP-seq
MIRT2433845	hsa-miR-432	CLIP-seq
MIRT2641305	hsa-miR-4511	CLIP-seq
MIRT2641306	hsa-miR-4512	CLIP-seq
MIRT1421538	hsa-miR-4652-3p	CLIP-seq
MIRT2433846	hsa-miR-4653-3p	CLIP-seq
MIRT2641307	hsa-miR-4659a-5p	CLIP-seq
MIRT2641308	hsa-miR-4659b-5p	CLIP-seq
MIRT2641309	hsa-miR-4694-3p	CLIP-seq
MIRT2433847	hsa-miR-4698	CLIP-seq
MIRT1421543	hsa-miR-4731-3p	CLIP-seq
MIRT2395734	hsa-miR-4776-3p	CLIP-seq
MIRT2641310	hsa-miR-4786-5p	CLIP-seq
MIRT1421546	hsa-miR-4801	CLIP-seq
MIRT2433851	hsa-miR-486-3p	CLIP-seq
MIRT2126433	hsa-miR-488	CLIP-seq
MIRT2641311	hsa-miR-489	CLIP-seq
MIRT2641312	hsa-miR-495	CLIP-seq
MIRT2641313	hsa-miR-548aa	CLIP-seq
MIRT2641314	hsa-miR-548ac	CLIP-seq
MIRT2641315	hsa-miR-548b-3p	CLIP-seq
MIRT2641316	hsa-miR-548d-3p	CLIP-seq
MIRT2126434	hsa-miR-548v	CLIP-seq
MIRT2641317	hsa-miR-548z	CLIP-seq
MIRT2641318	hsa-miR-556-3p	CLIP-seq
MIRT2641319	hsa-miR-564	CLIP-seq
MIRT1421552	hsa-miR-570	CLIP-seq
MIRT2641320	hsa-miR-586	CLIP-seq
MIRT2641321	hsa-miR-624	CLIP-seq
MIRT2641322	hsa-miR-634	CLIP-seq
MIRT2395735	hsa-miR-642b	CLIP-seq
MIRT2126435	hsa-miR-659	CLIP-seq
MIRT2641323	hsa-miR-769-5p	CLIP-seq
MIRT2641324	hsa-miR-876-5p	CLIP-seq
MIRT2693027	hsa-let-7a	CLIP-seq
MIRT2693028	hsa-let-7b	CLIP-seq
MIRT2693029	hsa-let-7c	CLIP-seq
MIRT2693030	hsa-let-7d	CLIP-seq
MIRT2693031	hsa-let-7e	CLIP-seq
MIRT2693032	hsa-let-7f	CLIP-seq
MIRT2693033	hsa-let-7g	CLIP-seq
MIRT2693034	hsa-let-7i	CLIP-seq
MIRT2693035	hsa-miR-101	CLIP-seq
MIRT1421506	hsa-miR-1237	CLIP-seq
MIRT2641292	hsa-miR-1238	CLIP-seq
MIRT2693036	hsa-miR-124	CLIP-seq
MIRT2641293	hsa-miR-1246	CLIP-seq
MIRT2641294	hsa-miR-1272	CLIP-seq
MIRT2126428	hsa-miR-1290	CLIP-seq
MIRT2693037	hsa-miR-1294	CLIP-seq
MIRT2641295	hsa-miR-129-5p	CLIP-seq
MIRT1421509	hsa-miR-1305	CLIP-seq
MIRT2126429	hsa-miR-139-5p	CLIP-seq
MIRT2693038	hsa-miR-144	CLIP-seq
MIRT1421510	hsa-miR-186	CLIP-seq
MIRT2126430	hsa-miR-193b	CLIP-seq
MIRT2693039	hsa-miR-196a	CLIP-seq
MIRT2693040	hsa-miR-196b	CLIP-seq
MIRT1421513	hsa-miR-202	CLIP-seq
MIRT2395732	hsa-miR-221	CLIP-seq
MIRT2395733	hsa-miR-222	CLIP-seq
MIRT2693041	hsa-miR-223	CLIP-seq
MIRT2693042	hsa-miR-2276	CLIP-seq
MIRT1421515	hsa-miR-23a	CLIP-seq
MIRT1421516	hsa-miR-23b	CLIP-seq
MIRT1421517	hsa-miR-23c	CLIP-seq
MIRT2693043	hsa-miR-298	CLIP-seq
MIRT2693044	hsa-miR-300	CLIP-seq
MIRT2433837	hsa-miR-3065-5p	CLIP-seq
MIRT2693045	hsa-miR-31	CLIP-seq
MIRT2641296	hsa-miR-3117-5p	CLIP-seq
MIRT2641297	hsa-miR-3148	CLIP-seq
MIRT2693046	hsa-miR-3155	CLIP-seq
MIRT2693047	hsa-miR-3155b	CLIP-seq
MIRT2693048	hsa-miR-3156-5p	CLIP-seq
MIRT2693049	hsa-miR-3158-5p	CLIP-seq
MIRT2693050	hsa-miR-3162-3p	CLIP-seq
MIRT2641298	hsa-miR-3167	CLIP-seq
MIRT1421527	hsa-miR-3182	CLIP-seq
MIRT2433839	hsa-miR-3194-3p	CLIP-seq
MIRT2433840	hsa-miR-3198	CLIP-seq
MIRT2693051	hsa-miR-3620	CLIP-seq
MIRT2641299	hsa-miR-3622b-5p	CLIP-seq
MIRT2641300	hsa-miR-3663-3p	CLIP-seq
MIRT2693052	hsa-miR-3714	CLIP-seq
MIRT2126431	hsa-miR-376a	CLIP-seq
MIRT2126432	hsa-miR-376b	CLIP-seq
MIRT2693053	hsa-miR-381	CLIP-seq
MIRT2641301	hsa-miR-382	CLIP-seq
MIRT2693054	hsa-miR-3910	CLIP-seq
MIRT2641302	hsa-miR-3942-3p	CLIP-seq
MIRT2433841	hsa-miR-4260	CLIP-seq
MIRT2693055	hsa-miR-4261	CLIP-seq
MIRT2641303	hsa-miR-4291	CLIP-seq
MIRT2693056	hsa-miR-4293	CLIP-seq
MIRT2641304	hsa-miR-4301	CLIP-seq
MIRT2433843	hsa-miR-4309	CLIP-seq
MIRT2433844	hsa-miR-4312	CLIP-seq
MIRT2693057	hsa-miR-4316	CLIP-seq
MIRT2433845	hsa-miR-432	CLIP-seq
MIRT2693058	hsa-miR-4418	CLIP-seq
MIRT1421534	hsa-miR-4422	CLIP-seq
MIRT2693059	hsa-miR-4481	CLIP-seq
MIRT2641305	hsa-miR-4511	CLIP-seq
MIRT2641306	hsa-miR-4512	CLIP-seq
MIRT2693060	hsa-miR-4530	CLIP-seq
MIRT2693061	hsa-miR-4540	CLIP-seq
MIRT1421538	hsa-miR-4652-3p	CLIP-seq
MIRT2433846	hsa-miR-4653-3p	CLIP-seq
MIRT2693062	hsa-miR-4658	CLIP-seq
MIRT2641307	hsa-miR-4659a-5p	CLIP-seq
MIRT2641308	hsa-miR-4659b-5p	CLIP-seq
MIRT2693063	hsa-miR-4677-3p	CLIP-seq
MIRT2693064	hsa-miR-4684-3p	CLIP-seq
MIRT2693065	hsa-miR-4684-5p	CLIP-seq
MIRT2641309	hsa-miR-4694-3p	CLIP-seq
MIRT2693066	hsa-miR-4697-3p	CLIP-seq
MIRT2433847	hsa-miR-4698	CLIP-seq
MIRT1421543	hsa-miR-4731-3p	CLIP-seq
MIRT2693067	hsa-miR-4745-5p	CLIP-seq
MIRT2693068	hsa-miR-4757-5p	CLIP-seq
MIRT2693069	hsa-miR-4758-5p	CLIP-seq
MIRT2693070	hsa-miR-4772-3p	CLIP-seq
MIRT2395734	hsa-miR-4776-3p	CLIP-seq
MIRT2641310	hsa-miR-4786-5p	CLIP-seq
MIRT1421546	hsa-miR-4801	CLIP-seq
MIRT2693071	hsa-miR-484	CLIP-seq
MIRT2433851	hsa-miR-486-3p	CLIP-seq
MIRT2126433	hsa-miR-488	CLIP-seq
MIRT2641311	hsa-miR-489	CLIP-seq
MIRT2641312	hsa-miR-495	CLIP-seq
MIRT2693072	hsa-miR-506	CLIP-seq
MIRT2693073	hsa-miR-509-3-5p	CLIP-seq
MIRT2693074	hsa-miR-509-5p	CLIP-seq
MIRT2641313	hsa-miR-548aa	CLIP-seq
MIRT2641314	hsa-miR-548ac	CLIP-seq
MIRT2641315	hsa-miR-548b-3p	CLIP-seq
MIRT2641316	hsa-miR-548d-3p	CLIP-seq
MIRT2348462	hsa-miR-548u	CLIP-seq
MIRT2126434	hsa-miR-548v	CLIP-seq
MIRT2641317	hsa-miR-548z	CLIP-seq
MIRT2641318	hsa-miR-556-3p	CLIP-seq
MIRT2641319	hsa-miR-564	CLIP-seq
MIRT1421552	hsa-miR-570	CLIP-seq
MIRT2641320	hsa-miR-586	CLIP-seq
MIRT2693075	hsa-miR-596	CLIP-seq
MIRT1421554	hsa-miR-607	CLIP-seq
MIRT1421555	hsa-miR-618	CLIP-seq
MIRT2641321	hsa-miR-624	CLIP-seq
MIRT2693076	hsa-miR-633	CLIP-seq
MIRT2641322	hsa-miR-634	CLIP-seq
MIRT2395735	hsa-miR-642b	CLIP-seq
MIRT2126435	hsa-miR-659	CLIP-seq
MIRT2641323	hsa-miR-769-5p	CLIP-seq
MIRT2693077	hsa-miR-873	CLIP-seq
MIRT2641324	hsa-miR-876-5p	CLIP-seq
MIRT1421558	hsa-miR-891b	CLIP-seq
MIRT2693078	hsa-miR-98	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
CREB5	Activation	21132541
GATA3	Unknown	24124001

Show/Hide all (95)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	IBA
GO:0001837	Process	Epithelial to mesenchymal transition	IDA	18184661
GO:0001889	Process	Liver development	ISS
GO:0003007	Process	Heart morphogenesis	ISS
GO:0003150	Process	Muscular septum morphogenesis	ISS
GO:0003151	Process	Outflow tract morphogenesis	ISS
GO:0003223	Process	Ventricular compact myocardium morphogenesis	ISS
GO:0004888	Function	Transmembrane signaling receptor activity	IDA	18184661
GO:0005024	Function	Transforming growth factor beta receptor activity	IBA
GO:0005024	Function	Transforming growth factor beta receptor activity	IDA	12958365
GO:0005114	Function	Type II transforming growth factor beta receptor binding	IBA
GO:0005114	Function	Type II transforming growth factor beta receptor binding	IDA	11157754
GO:0005160	Function	Transforming growth factor beta receptor binding	IEA
GO:0005160	Function	Transforming growth factor beta receptor binding	ISS	1333192
GO:0005515	Function	Protein binding	IPI	10746731
GO:0005515	Function	Protein binding	IPI	10746731, 11157754, 11546783, 12958365, 20856203
GO:0005539	Function	Glycosaminoglycan binding	IBA
GO:0005539	Function	Glycosaminoglycan binding	ISS
GO:0005539	Function	Glycosaminoglycan binding	TAS	1333192
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	18184661
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IMP	16886151
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IBA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	12958365, 29130787
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IMP	11157754, 30467960
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	ISS
GO:0007181	Process	Transforming growth factor beta receptor complex assembly	IEA
GO:0008201	Function	Heparin binding	IEA
GO:0008201	Function	Heparin binding	ISS	1333192
GO:0009897	Component	External side of plasma membrane	IDA	12958365
GO:0009986	Component	Cell surface	ISS
GO:0010628	Process	Positive regulation of gene expression	IMP	30467960
GO:0015026	Function	Coreceptor activity	IDA	10746731
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	TAS
GO:0016477	Process	Cell migration	IBA
GO:0016477	Process	Cell migration	ISS
GO:0017015	Process	Regulation of transforming growth factor beta receptor signaling pathway	IBA
GO:0017134	Function	Fibroblast growth factor binding	IEA
GO:0030165	Function	PDZ domain binding	ISS
GO:0030336	Process	Negative regulation of cell migration	IDA	29130787
GO:0030509	Process	BMP signaling pathway	IDA	18184661
GO:0030511	Process	Positive regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0031100	Process	Animal organ regeneration	IEA
GO:0032354	Process	Response to follicle-stimulating hormone	IDA	14557487
GO:0034673	Component	Inhibin-betaglycan-ActRII complex	IDA	10746731
GO:0034695	Process	Response to prostaglandin E	IDA	14557487
GO:0034699	Process	Response to luteinizing hormone	IDA	14557487
GO:0035556	Process	Intracellular signal transduction	IMP	14557487
GO:0036122	Function	BMP binding	IPI	18184661
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	29130787
GO:0043235	Component	Receptor complex	IDA	11157754
GO:0043235	Component	Receptor complex	IEA
GO:0046328	Process	Regulation of JNK cascade	ISS
GO:0046332	Function	SMAD binding	IMP	11157754
GO:0048185	Function	Activin binding	IEA
GO:0050431	Function	Transforming growth factor beta binding	IBA
GO:0050431	Function	Transforming growth factor beta binding	IDA	11157754, 12958365
GO:0050431	Function	Transforming growth factor beta binding	IEA
GO:0050431	Function	Transforming growth factor beta binding	IPI	11157754
GO:0050680	Process	Negative regulation of epithelial cell proliferation	ISS
GO:0055010	Process	Ventricular cardiac muscle tissue morphogenesis	ISS
GO:0060038	Process	Cardiac muscle cell proliferation	ISS
GO:0060045	Process	Positive regulation of cardiac muscle cell proliferation	ISS
GO:0060216	Process	Definitive hemopoiesis	ISS
GO:0060317	Process	Cardiac epithelial to mesenchymal transition	IDA	18184661
GO:0060318	Process	Definitive erythrocyte differentiation	ISS
GO:0060347	Process	Heart trabecula formation	ISS
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IDA	18184661
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IMP	11157754, 30729664
GO:0060392	Process	Negative regulation of SMAD protein signal transduction	IMP	30729664
GO:0060412	Process	Ventricular septum morphogenesis	ISS
GO:0060939	Process	Epicardium-derived cardiac fibroblast cell development	ISS
GO:0060979	Process	Vasculogenesis involved in coronary vascular morphogenesis	ISS
GO:0061384	Process	Heart trabecula morphogenesis	ISS
GO:0062009	Process	Secondary palate development	ISS
GO:0065003	Process	Protein-containing complex assembly	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708
GO:0070123	Function	Transforming growth factor beta receptor activity, type III	IDA	10746731, 11157754
GO:0070123	Function	Transforming growth factor beta receptor activity, type III	IEA
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	ISS
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0071944	Component	Cell periphery	IEA
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IMP	30467960
GO:0090100	Process	Positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway	IEA
GO:1901202	Process	Negative regulation of extracellular matrix assembly	IMP	30729664

MIM	HGNC	e!Ensembl
600742	11774	ENSG00000069702

Q03167

Protein name

Transforming growth factor beta receptor type 3 (TGF-beta receptor type 3) (TGFR-3) (Betaglycan) (Transforming growth factor beta receptor III) (TGF-beta receptor type III)

Protein function

Cell surface receptor that regulates diverse cellular processes including cell proliferation, differentiation, migration, and apoptosis (PubMed:12958365, PubMed:19416857). Initiates BMP, inhibin, and TGF-beta signaling pathways by interacting wi

PDB

7LBG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00100	Zona_pellucida	456 → 724	Zona pellucida-like domain	Family

Sequence

MTSHYVIAIFALMSSCLATAGPEPGALCELSPVSASHPVQALMESFTVLSGCASRGTTGL
PQEVHVLNLRTAGQGPGQLQREVTLHLNPISSVHIHHKSVVFLLNSPHPLVWHLKTERLA
TGVSRLFLVSEGSVVQFSSANFSLTAETEERNFPHGNEHLLNWARKEYGAVTSFTELKIA
RNIYIKVGEDQVFPPKCNIGKNFLSLNYLAEYLQPKAAEGCVMSSQPQNEEVHIIELITP
NSNPYSAFQVDITIDIRPSQEDLEVVKNLILILKCKKSVNWVIKSFDVKGSLKIIAPNSI
GFGKESERSMTMTKSIRDDIPSTQGNLVKWALDNGYSPITSYTMAPVANRFHLRLENNAE
EMGDEEVHTIPPELRILLDPGALPALQNPPIRGGEGQNGGLPFPFPDISRRVWNEEGEDG
LPRPKDPVIPSIQLFPGLREPEEVQGSVDIALSVKCDNEKMIVAVEKDSFQASGYSGMDV
TLLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGY
EDLESGDNGFPGDMDEGDASLFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNT
DLFLVPSQGVFSVPENGHVYVEVSVTKAEQELGFAIQTCFISPYSNPDRMSHYTIIENIC
PKDESVKFYSPKRVHFPIPQADMDKKRFSFVFKPVFNTSLLFLQCELTLCTKMEKHPQKL
PKCVPPDEACTSLDASIIWAMMQNKKTFTKPLAVIHHEAESKEKGPSMKEPNPISPPIFH
GLDTLTVMGIAFAAFVIGALLTGALWYIYSHTGETAGRQQVPTSPPASENSSAAHSIGST
QSTPCSSSSTA

Sequence length

851

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (23)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONNECTIVE TISSUE DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Connective tissue disorder	Likely benign; Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFUSE GASTRIC ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL CEREBRAL SACCULAR ANEURYSM	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial thoracic aortic aneurysm and aortic dissection	Benign; Likely benign; Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Gastric cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Infertility disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUTROPENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TGFBR3-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (136)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	LHGDN	15745937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	29769567		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha-Thalassemia	alpha Thalassemia	BEFREE	21515823		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha^+^ Thalassemia	alpha Thalassemia	BEFREE	21515823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17660861, 31989994	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	37801139	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	21515823, 33062074, 33149723, 35781614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANEURYSM, INTRACRANIAL BERRY, 1 (disorder)	Intracranial Aneurysm	ORPHANET_DG	19299629		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31307515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	39738466, 40139558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	34201265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20386084		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	20386084	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	35369660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	22440163, 25677673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23835618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	33062074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23925295, 24337772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	36430763	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24337772, 33819300, 34055036, 35607268, 40372160	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	33325535	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29991755	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23835618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24305048, 29707897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	16621788, 20208565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34890627	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	30255099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	34201265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	21515823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	29267209	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	19131638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	24589633	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11029459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33008876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Congenital hyperinsulinism	Pubtator	18931647	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20208565, 29391598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	25390077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	Pubtator	25390077	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	18398939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	23092981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	17660861	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	28736931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalomalacia	Encephalomalacia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26548418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	16621788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	33146446, 34725559, 36461008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	33146446, 36461008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial cerebral saccular aneurysm	Cerebral Saccular Aneurysm	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma	Glaucoma	BEFREE	21427129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	32606567	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	25861811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	25861811, 26383992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	35369660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure Diastolic	Heart failure	Pubtator	28105587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolysis	Hemolysis	Pubtator	33062074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	36976645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	11282888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	18097622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	11282888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	23962103, 34285914	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	11282888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	33764282	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	19299629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	19299629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	29725386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	31525642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19639191, 21829018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21742797	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	35369660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33146446	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	14704634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23925295, 24337772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26548418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24305048, 29707897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17192875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23835618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21261473, 25716682, 26548418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11029459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	29198452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	29198452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	23092981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28559372, 31401194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	36976645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	23387308	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23835618, 23925295, 24705316, 24985072, 26980036, 29084941, 29991755, 31307515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10735501, 24216509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	24216509	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18174241, 24305048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculomotor Nerve Paralysis	Oculomotor nerve palsy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	19303468, 29514696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	30553836	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	GWASCAT_DG	29559693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	GWASCAT_DG	29559693		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	Pubtator	34201265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29991755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	39595984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	16613887, 21756058, 22036907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	LHGDN	17084394		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	14557487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19164448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19416857	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	31307515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	17999987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34010341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	30609812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	16613887, 21756058, 22036907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary physiologic amenorrhea	Physiologic Amenorrhea	BEFREE	16613887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17192875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17192875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31409900, 34860853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	19131638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	12970754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	34755406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	21717526, 28692601, 29979612, 35546636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	24705316, 26980036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sex Cord-Stromal Tumor	Sex Cord-Stromal Tumor	BEFREE	14557487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	24194869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	23177593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	25728212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29130787	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31525642, 32931492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	29130787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	21515823	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	30027931	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	34767591	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	24124001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24985072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24124001	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	21132541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	22440163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	22440163		★★★★★ ★☆☆☆☆ Found in Text Mining only

TGFBR3 (transforming growth factor beta receptor 3)