Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7039
Gene name	Transforming growth factor alpha
Gene symbol	TGFA
Synonyms (NCBI Gene)	TFGA
Chromosome	2
Chromosome location	2p13.3
Summary	This gene encodes a growth factor that is a ligand for the epidermal growth factor receptor, which activates a signaling pathway for cell proliferation, differentiation and development. This protein may act as either a transmembrane-bound ligand or a solu

345

Show/Hide all (345)

miRTarBase ID	miRNA	Experiments	Reference
MIRT035552	hsa-miR-152-3p	Luciferase reporter assay	23460133
MIRT035552	hsa-miR-152-3p	Luciferase reporter assay	23460133
MIRT049451	hsa-miR-92a-3p	CLASH	23622248
MIRT437890	hsa-miR-376c-3p	Luciferase reporter assayWestern blot	23631646
MIRT437890	hsa-miR-376c-3p	Luciferase reporter assayWestern blot	23631646
MIRT712905	hsa-miR-1539	HITS-CLIP	19536157
MIRT712904	hsa-miR-3193	HITS-CLIP	19536157
MIRT712903	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT712902	hsa-miR-1976	HITS-CLIP	19536157
MIRT712901	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT712900	hsa-miR-1913	HITS-CLIP	19536157
MIRT712899	hsa-miR-324-3p	HITS-CLIP	19536157
MIRT712898	hsa-miR-18a-3p	HITS-CLIP	19536157
MIRT712897	hsa-miR-4734	HITS-CLIP	19536157
MIRT712896	hsa-miR-4641	HITS-CLIP	19536157
MIRT712895	hsa-miR-4706	HITS-CLIP	19536157
MIRT712894	hsa-miR-4749-5p	HITS-CLIP	19536157
MIRT712893	hsa-miR-744-5p	HITS-CLIP	19536157
MIRT712892	hsa-miR-4727-5p	HITS-CLIP	19536157
MIRT712891	hsa-miR-5001-3p	HITS-CLIP	19536157
MIRT712890	hsa-miR-6738-3p	HITS-CLIP	19536157
MIRT712905	hsa-miR-1539	HITS-CLIP	19536157
MIRT712904	hsa-miR-3193	HITS-CLIP	19536157
MIRT712903	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT712902	hsa-miR-1976	HITS-CLIP	19536157
MIRT712901	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT712900	hsa-miR-1913	HITS-CLIP	19536157
MIRT712899	hsa-miR-324-3p	HITS-CLIP	19536157
MIRT712898	hsa-miR-18a-3p	HITS-CLIP	19536157
MIRT712897	hsa-miR-4734	HITS-CLIP	19536157
MIRT712896	hsa-miR-4641	HITS-CLIP	19536157
MIRT712895	hsa-miR-4706	HITS-CLIP	19536157
MIRT712894	hsa-miR-4749-5p	HITS-CLIP	19536157
MIRT712893	hsa-miR-744-5p	HITS-CLIP	19536157
MIRT712892	hsa-miR-4727-5p	HITS-CLIP	19536157
MIRT712891	hsa-miR-5001-3p	HITS-CLIP	19536157
MIRT712890	hsa-miR-6738-3p	HITS-CLIP	19536157
MIRT712905	hsa-miR-1539	HITS-CLIP	19536157
MIRT712904	hsa-miR-3193	HITS-CLIP	19536157
MIRT712903	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT712902	hsa-miR-1976	HITS-CLIP	19536157
MIRT712901	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT712900	hsa-miR-1913	HITS-CLIP	19536157
MIRT712899	hsa-miR-324-3p	HITS-CLIP	19536157
MIRT712898	hsa-miR-18a-3p	HITS-CLIP	19536157
MIRT712897	hsa-miR-4734	HITS-CLIP	19536157
MIRT712896	hsa-miR-4641	HITS-CLIP	19536157
MIRT712895	hsa-miR-4706	HITS-CLIP	19536157
MIRT712894	hsa-miR-4749-5p	HITS-CLIP	19536157
MIRT712893	hsa-miR-744-5p	HITS-CLIP	19536157
MIRT712892	hsa-miR-4727-5p	HITS-CLIP	19536157
MIRT712891	hsa-miR-5001-3p	HITS-CLIP	19536157
MIRT712890	hsa-miR-6738-3p	HITS-CLIP	19536157
MIRT652747	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT652746	hsa-miR-6817-3p	HITS-CLIP	19536157
MIRT652744	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT652743	hsa-miR-6818-5p	HITS-CLIP	19536157
MIRT652747	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT652746	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT652745	hsa-miR-222-5p	HITS-CLIP	23824327
MIRT652744	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT652743	hsa-miR-6818-5p	HITS-CLIP	23824327
MIRT652747	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT652746	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT652745	hsa-miR-222-5p	HITS-CLIP	23824327
MIRT652744	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT652743	hsa-miR-6818-5p	HITS-CLIP	23824327
MIRT444605	hsa-miR-6757-5p	PAR-CLIP	22100165
MIRT444604	hsa-miR-4495	PAR-CLIP	22100165
MIRT444603	hsa-miR-6814-5p	PAR-CLIP	22100165
MIRT444602	hsa-miR-3136-3p	PAR-CLIP	22100165
MIRT444601	hsa-miR-7155-3p	PAR-CLIP	22100165
MIRT444599	hsa-miR-30a-5p	PAR-CLIP	22100165
MIRT444600	hsa-miR-30b-5p	PAR-CLIP	22100165
MIRT444598	hsa-miR-30c-5p	PAR-CLIP	22100165
MIRT444597	hsa-miR-30d-5p	PAR-CLIP	22100165
MIRT444596	hsa-miR-30e-5p	PAR-CLIP	22100165
MIRT444595	hsa-miR-7158-3p	PAR-CLIP	22100165
MIRT444594	hsa-miR-203b-3p	PAR-CLIP	22100165
MIRT736318	hsa-miR-340-5p	Luciferase reporter assayqRT-PCR	33661995
MIRT712905	hsa-miR-1539	HITS-CLIP	19536157
MIRT712904	hsa-miR-3193	HITS-CLIP	19536157
MIRT712903	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT712902	hsa-miR-1976	HITS-CLIP	19536157
MIRT712901	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT712900	hsa-miR-1913	HITS-CLIP	19536157
MIRT712899	hsa-miR-324-3p	HITS-CLIP	19536157
MIRT712898	hsa-miR-18a-3p	HITS-CLIP	19536157
MIRT712897	hsa-miR-4734	HITS-CLIP	19536157
MIRT712896	hsa-miR-4641	HITS-CLIP	19536157
MIRT712895	hsa-miR-4706	HITS-CLIP	19536157
MIRT712894	hsa-miR-4749-5p	HITS-CLIP	19536157
MIRT712893	hsa-miR-744-5p	HITS-CLIP	19536157
MIRT712892	hsa-miR-4727-5p	HITS-CLIP	19536157
MIRT712891	hsa-miR-5001-3p	HITS-CLIP	19536157
MIRT712890	hsa-miR-6738-3p	HITS-CLIP	19536157
MIRT712905	hsa-miR-1539	HITS-CLIP	19536157
MIRT712904	hsa-miR-3193	HITS-CLIP	19536157
MIRT712903	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT712902	hsa-miR-1976	HITS-CLIP	19536157
MIRT712901	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT712900	hsa-miR-1913	HITS-CLIP	19536157
MIRT712899	hsa-miR-324-3p	HITS-CLIP	19536157
MIRT712898	hsa-miR-18a-3p	HITS-CLIP	19536157
MIRT712897	hsa-miR-4734	HITS-CLIP	19536157
MIRT712896	hsa-miR-4641	HITS-CLIP	19536157
MIRT712895	hsa-miR-4706	HITS-CLIP	19536157
MIRT712894	hsa-miR-4749-5p	HITS-CLIP	19536157
MIRT712893	hsa-miR-744-5p	HITS-CLIP	19536157
MIRT712892	hsa-miR-4727-5p	HITS-CLIP	19536157
MIRT712891	hsa-miR-5001-3p	HITS-CLIP	19536157
MIRT712890	hsa-miR-6738-3p	HITS-CLIP	19536157
MIRT712905	hsa-miR-1539	HITS-CLIP	19536157
MIRT712904	hsa-miR-3193	HITS-CLIP	19536157
MIRT712903	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT712902	hsa-miR-1976	HITS-CLIP	19536157
MIRT712901	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT712900	hsa-miR-1913	HITS-CLIP	19536157
MIRT712899	hsa-miR-324-3p	HITS-CLIP	19536157
MIRT712898	hsa-miR-18a-3p	HITS-CLIP	19536157
MIRT712897	hsa-miR-4734	HITS-CLIP	19536157
MIRT712896	hsa-miR-4641	HITS-CLIP	19536157
MIRT712895	hsa-miR-4706	HITS-CLIP	19536157
MIRT712894	hsa-miR-4749-5p	HITS-CLIP	19536157
MIRT712893	hsa-miR-744-5p	HITS-CLIP	19536157
MIRT712892	hsa-miR-4727-5p	HITS-CLIP	19536157
MIRT712891	hsa-miR-5001-3p	HITS-CLIP	19536157
MIRT712890	hsa-miR-6738-3p	HITS-CLIP	19536157
MIRT652747	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT652746	hsa-miR-6817-3p	HITS-CLIP	19536157
MIRT652744	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT652743	hsa-miR-6818-5p	HITS-CLIP	19536157
MIRT652747	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT652746	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT652745	hsa-miR-222-5p	HITS-CLIP	23824327
MIRT652744	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT652743	hsa-miR-6818-5p	HITS-CLIP	23824327
MIRT652747	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT652746	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT652745	hsa-miR-222-5p	HITS-CLIP	23824327
MIRT652744	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT652743	hsa-miR-6818-5p	HITS-CLIP	23824327
MIRT444605	hsa-miR-6757-5p	PAR-CLIP	22100165
MIRT444604	hsa-miR-4495	PAR-CLIP	22100165
MIRT444603	hsa-miR-6814-5p	PAR-CLIP	22100165
MIRT444602	hsa-miR-3136-3p	PAR-CLIP	22100165
MIRT444601	hsa-miR-7155-3p	PAR-CLIP	22100165
MIRT444599	hsa-miR-30a-5p	PAR-CLIP	22100165
MIRT444600	hsa-miR-30b-5p	PAR-CLIP	22100165
MIRT444598	hsa-miR-30c-5p	PAR-CLIP	22100165
MIRT444597	hsa-miR-30d-5p	PAR-CLIP	22100165
MIRT444596	hsa-miR-30e-5p	PAR-CLIP	22100165
MIRT444595	hsa-miR-7158-3p	PAR-CLIP	22100165
MIRT444594	hsa-miR-203b-3p	PAR-CLIP	22100165
MIRT1420997	hsa-miR-101	CLIP-seq
MIRT1420998	hsa-miR-125a-3p	CLIP-seq
MIRT1420999	hsa-miR-1294	CLIP-seq
MIRT1421000	hsa-miR-1298	CLIP-seq
MIRT1421001	hsa-miR-130a	CLIP-seq
MIRT1421002	hsa-miR-130b	CLIP-seq
MIRT1421003	hsa-miR-144	CLIP-seq
MIRT1421004	hsa-miR-148a	CLIP-seq
MIRT1421005	hsa-miR-148b	CLIP-seq
MIRT1421006	hsa-miR-152	CLIP-seq
MIRT1421007	hsa-miR-205	CLIP-seq
MIRT1421008	hsa-miR-2052	CLIP-seq
MIRT1421009	hsa-miR-217	CLIP-seq
MIRT1421010	hsa-miR-2355-5p	CLIP-seq
MIRT1421011	hsa-miR-28-3p	CLIP-seq
MIRT1421012	hsa-miR-301a	CLIP-seq
MIRT1421013	hsa-miR-301b	CLIP-seq
MIRT1421014	hsa-miR-3065-5p	CLIP-seq
MIRT1421015	hsa-miR-3128	CLIP-seq
MIRT1421016	hsa-miR-3140-3p	CLIP-seq
MIRT1421017	hsa-miR-3152-3p	CLIP-seq
MIRT1421018	hsa-miR-3164	CLIP-seq
MIRT1421019	hsa-miR-3173-3p	CLIP-seq
MIRT1421020	hsa-miR-326	CLIP-seq
MIRT1421021	hsa-miR-330-5p	CLIP-seq
MIRT1421022	hsa-miR-34a	CLIP-seq
MIRT1421023	hsa-miR-34c-5p	CLIP-seq
MIRT1421024	hsa-miR-3666	CLIP-seq
MIRT1421025	hsa-miR-3667-3p	CLIP-seq
MIRT1421026	hsa-miR-3681	CLIP-seq
MIRT1421027	hsa-miR-3688-5p	CLIP-seq
MIRT1421028	hsa-miR-3689d	CLIP-seq
MIRT1421029	hsa-miR-3913-3p	CLIP-seq
MIRT1421030	hsa-miR-3934	CLIP-seq
MIRT1421031	hsa-miR-3942-3p	CLIP-seq
MIRT1421032	hsa-miR-4276	CLIP-seq
MIRT1421033	hsa-miR-4286	CLIP-seq
MIRT1421034	hsa-miR-4295	CLIP-seq
MIRT1421035	hsa-miR-4316	CLIP-seq
MIRT1421036	hsa-miR-4422	CLIP-seq
MIRT1421037	hsa-miR-4428	CLIP-seq
MIRT1421038	hsa-miR-4438	CLIP-seq
MIRT1421039	hsa-miR-4477a	CLIP-seq
MIRT1421040	hsa-miR-4477b	CLIP-seq
MIRT1421041	hsa-miR-4493	CLIP-seq
MIRT1421042	hsa-miR-449a	CLIP-seq
MIRT1421043	hsa-miR-449b	CLIP-seq
MIRT1421044	hsa-miR-4501	CLIP-seq
MIRT1421045	hsa-miR-454	CLIP-seq
MIRT1421046	hsa-miR-4645-5p	CLIP-seq
MIRT1421047	hsa-miR-4673	CLIP-seq
MIRT1421048	hsa-miR-4704-3p	CLIP-seq
MIRT1421049	hsa-miR-4720-5p	CLIP-seq
MIRT1421050	hsa-miR-4755-3p	CLIP-seq
MIRT1421051	hsa-miR-4757-5p	CLIP-seq
MIRT1421052	hsa-miR-4760-3p	CLIP-seq
MIRT1421053	hsa-miR-4789-3p	CLIP-seq
MIRT737908	hsa-miR-4793-5p	CLIP-seq
MIRT1421054	hsa-miR-4797-5p	CLIP-seq
MIRT1421055	hsa-miR-4799-3p	CLIP-seq
MIRT1421056	hsa-miR-495	CLIP-seq
MIRT1421057	hsa-miR-499-3p	CLIP-seq
MIRT1421058	hsa-miR-499a-3p	CLIP-seq
MIRT1421059	hsa-miR-5095	CLIP-seq
MIRT1421060	hsa-miR-512-3p	CLIP-seq
MIRT1421061	hsa-miR-526b	CLIP-seq
MIRT1421062	hsa-miR-545	CLIP-seq
MIRT1421063	hsa-miR-548ag	CLIP-seq
MIRT1421064	hsa-miR-548ai	CLIP-seq
MIRT1421065	hsa-miR-552	CLIP-seq
MIRT1421066	hsa-miR-570	CLIP-seq
MIRT1421067	hsa-miR-626	CLIP-seq
MIRT1421068	hsa-miR-664	CLIP-seq
MIRT1421069	hsa-miR-759	CLIP-seq
MIRT1421070	hsa-miR-124	CLIP-seq
MIRT1421071	hsa-miR-1264	CLIP-seq
MIRT1421072	hsa-miR-1285	CLIP-seq
MIRT1421001	hsa-miR-130a	CLIP-seq
MIRT1421002	hsa-miR-130b	CLIP-seq
MIRT1421073	hsa-miR-1321	CLIP-seq
MIRT1421004	hsa-miR-148a	CLIP-seq
MIRT1421005	hsa-miR-148b	CLIP-seq
MIRT1421006	hsa-miR-152	CLIP-seq
MIRT1421074	hsa-miR-216a	CLIP-seq
MIRT1421075	hsa-miR-27a	CLIP-seq
MIRT1421076	hsa-miR-27b	CLIP-seq
MIRT1421012	hsa-miR-301a	CLIP-seq
MIRT1421013	hsa-miR-301b	CLIP-seq
MIRT1421077	hsa-miR-3117-5p	CLIP-seq
MIRT1421078	hsa-miR-3138	CLIP-seq
MIRT1421016	hsa-miR-3140-3p	CLIP-seq
MIRT1421079	hsa-miR-3162-5p	CLIP-seq
MIRT1421018	hsa-miR-3164	CLIP-seq
MIRT1421080	hsa-miR-3169	CLIP-seq
MIRT1421081	hsa-miR-3187-5p	CLIP-seq
MIRT1421082	hsa-miR-3202	CLIP-seq
MIRT1421083	hsa-miR-330-3p	CLIP-seq
MIRT1421024	hsa-miR-3666	CLIP-seq
MIRT1421026	hsa-miR-3681	CLIP-seq
MIRT1421028	hsa-miR-3689d	CLIP-seq
MIRT1421084	hsa-miR-369-3p	CLIP-seq
MIRT1421085	hsa-miR-374a	CLIP-seq
MIRT1421086	hsa-miR-374b	CLIP-seq
MIRT1421029	hsa-miR-3913-3p	CLIP-seq
MIRT1421032	hsa-miR-4276	CLIP-seq
MIRT1421034	hsa-miR-4295	CLIP-seq
MIRT1421087	hsa-miR-4491	CLIP-seq
MIRT1421088	hsa-miR-4513	CLIP-seq
MIRT1421089	hsa-miR-4533	CLIP-seq
MIRT1421045	hsa-miR-454	CLIP-seq
MIRT1421090	hsa-miR-4643	CLIP-seq
MIRT1421091	hsa-miR-4657	CLIP-seq
MIRT1421092	hsa-miR-4711-5p	CLIP-seq
MIRT1421093	hsa-miR-4736	CLIP-seq
MIRT1421094	hsa-miR-4739	CLIP-seq
MIRT1421095	hsa-miR-4740-5p	CLIP-seq
MIRT1421096	hsa-miR-4756-5p	CLIP-seq
MIRT1421097	hsa-miR-4795-3p	CLIP-seq
MIRT1421098	hsa-miR-4800-5p	CLIP-seq
MIRT1421099	hsa-miR-506	CLIP-seq
MIRT1421100	hsa-miR-513a-5p	CLIP-seq
MIRT1421101	hsa-miR-513c	CLIP-seq
MIRT1421102	hsa-miR-514b-5p	CLIP-seq
MIRT1421103	hsa-miR-549	CLIP-seq
MIRT1421104	hsa-miR-612	CLIP-seq
MIRT1421105	hsa-miR-657	CLIP-seq
MIRT1421106	hsa-miR-7	CLIP-seq
MIRT1421069	hsa-miR-759	CLIP-seq
MIRT1421107	hsa-miR-890	CLIP-seq
MIRT737907	hsa-miR-3140-5p	CLIP-seq
MIRT737909	hsa-miR-3148	CLIP-seq
MIRT737906	hsa-miR-3688-3p	CLIP-seq
MIRT737911	hsa-miR-3915	CLIP-seq
MIRT737910	hsa-miR-3928	CLIP-seq
MIRT737912	hsa-miR-4790-3p	CLIP-seq
MIRT737908	hsa-miR-4793-5p	CLIP-seq
MIRT2126336	hsa-miR-1200	CLIP-seq
MIRT2126337	hsa-miR-1207-5p	CLIP-seq
MIRT2126338	hsa-miR-134	CLIP-seq
MIRT2126339	hsa-miR-198	CLIP-seq
MIRT2126340	hsa-miR-3118	CLIP-seq
MIRT1421018	hsa-miR-3164	CLIP-seq
MIRT2126341	hsa-miR-34b	CLIP-seq
MIRT2126342	hsa-miR-3657	CLIP-seq
MIRT1421030	hsa-miR-3934	CLIP-seq
MIRT2126343	hsa-miR-4308	CLIP-seq
MIRT2126344	hsa-miR-4324	CLIP-seq
MIRT2126345	hsa-miR-4669	CLIP-seq
MIRT1421093	hsa-miR-4736	CLIP-seq
MIRT2126346	hsa-miR-4763-3p	CLIP-seq
MIRT2126347	hsa-miR-544b	CLIP-seq
MIRT1421106	hsa-miR-7	CLIP-seq
MIRT1421031	hsa-miR-3942-3p	CLIP-seq
MIRT1420997	hsa-miR-101	CLIP-seq
MIRT2126336	hsa-miR-1200	CLIP-seq
MIRT2348356	hsa-miR-1237	CLIP-seq
MIRT2348357	hsa-miR-1248	CLIP-seq
MIRT1421003	hsa-miR-144	CLIP-seq
MIRT2348358	hsa-miR-1914	CLIP-seq
MIRT2348359	hsa-miR-302f	CLIP-seq
MIRT2348360	hsa-miR-3147	CLIP-seq
MIRT2348361	hsa-miR-323-3p	CLIP-seq
MIRT1421025	hsa-miR-3667-3p	CLIP-seq
MIRT2126344	hsa-miR-4324	CLIP-seq
MIRT2348362	hsa-miR-4425	CLIP-seq
MIRT2348363	hsa-miR-4778-5p	CLIP-seq
MIRT737908	hsa-miR-4793-5p	CLIP-seq
MIRT2126347	hsa-miR-544b	CLIP-seq
MIRT1421063	hsa-miR-548ag	CLIP-seq
MIRT1421064	hsa-miR-548ai	CLIP-seq
MIRT1421029	hsa-miR-3913-3p	CLIP-seq
MIRT1421083	hsa-miR-330-3p	CLIP-seq
MIRT1421106	hsa-miR-7	CLIP-seq
MIRT1421083	hsa-miR-330-3p	CLIP-seq
MIRT1421106	hsa-miR-7	CLIP-seq
MIRT2692958	hsa-miR-2682	CLIP-seq
MIRT1421083	hsa-miR-330-3p	CLIP-seq
MIRT2692959	hsa-miR-3686	CLIP-seq
MIRT2692960	hsa-miR-4290	CLIP-seq
MIRT2692961	hsa-miR-4299	CLIP-seq
MIRT2692962	hsa-miR-4328	CLIP-seq
MIRT2692963	hsa-miR-449c	CLIP-seq
MIRT2692964	hsa-miR-4514	CLIP-seq
MIRT2692965	hsa-miR-455-5p	CLIP-seq
MIRT2692966	hsa-miR-4635	CLIP-seq
MIRT2692967	hsa-miR-4652-3p	CLIP-seq
MIRT2692968	hsa-miR-4692	CLIP-seq
MIRT2692969	hsa-miR-4699-5p	CLIP-seq
MIRT2692970	hsa-miR-4709-3p	CLIP-seq
MIRT2692971	hsa-miR-582-3p	CLIP-seq
MIRT1421106	hsa-miR-7	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
AR	Activation	11556855
ESR1	Activation	11517191
ESR1	Unknown	10828826
ESR2	Activation	11517191
SP1	Unknown	10828826

Show/Hide all (44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005154	Function	Epidermal growth factor receptor binding	IBA
GO:0005154	Function	Epidermal growth factor receptor binding	IDA	6315706, 11278323
GO:0005515	Function	Protein binding	IPI	12297049, 15064403, 15652357, 18757723, 24658140, 25416956, 28988771, 31980649, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	8702723
GO:0005615	Component	Extracellular space	IDA	12743035
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	10918572
GO:0007166	Process	Cell surface receptor signaling pathway	IDA	11278323
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IBA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IDA	6315706
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IEA
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IDA	11278323
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0009986	Component	Cell surface	IDA	12743035
GO:0012507	Component	ER to Golgi transport vesicle membrane	TAS
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	17553928
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IEA
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0031410	Component	Cytoplasmic vesicle	IDA	15064403
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	TAS
GO:0035556	Process	Intracellular signal transduction	TAS	10861448
GO:0038134	Process	ERBB2-EGFR signaling pathway	IDA	8702723
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	11278323
GO:0045840	Process	Positive regulation of mitotic nuclear division	IBA
GO:0048018	Function	Receptor ligand activity	IDA	8702723
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	15064403
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IDA	11278323
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0060749	Process	Mammary gland alveolus development	IEA
GO:0072574	Process	Hepatocyte proliferation	IEA

MIM	HGNC	e!Ensembl
190170	11765	ENSG00000163235

P01135

Protein name

Protransforming growth factor alpha [Cleaved into: Transforming growth factor alpha (TGF-alpha) (EGF-like TGF) (ETGF) (TGF type 1)]

Protein function

TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.

PDB

1GK5 , 1MOX , 1YUF , 1YUG , 2TGF , 3E50 , 3TGF , 4TGF , 5KN5 , 7SZ5 , 7SZ7

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Isoform 1, isoform 3 and isoform 4 are expressed in keratinocytes and tumor-derived cell lines. {ECO:0000269|PubMed:10523832}.

Sequence

MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV

Sequence length

160

Interactions

View interactions

	KEGG		Reactome
	EGFR tyrosine kinase inhibitor resistance MAPK signaling pathway ErbB signaling pathway Ras signaling pathway Calcium signaling pathway PI3K-Akt signaling pathway Estrogen signaling pathway Pathways in cancer Colorectal cancer Renal cell carcinoma Pancreatic cancer Glioma Prostate cancer Non-small cell lung cancer Hepatocellular carcinoma		PIP3 activates AKT signaling Signaling by EGFR GRB2 events in EGFR signaling GAB1 signalosome SHC1 events in EGFR signaling EGFR downregulation COPII-mediated vesicle transport EGFR interacts with phospholipase C-gamma Constitutive Signaling by Aberrant PI3K in Cancer Inhibition of Signaling by Overexpressed EGFR RAF/MAP kinase cascade Cargo concentration in the ER PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling Cargo recognition for clathrin-mediated endocytosis Clathrin-mediated endocytosis TFAP2 (AP-2) family regulates transcription of growth factors and their receptors Extra-nuclear estrogen signaling Estrogen-dependent gene expression Estrogen-dependent nuclear events downstream of ESR-membrane signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (29)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FRONTOTEMPORAL DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROENTERITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC PREDISPOSITION TO DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEAD AND NECK NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOBLASTOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION, PULMONARY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHY, RIGHT VENTRICULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOSITIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HAND	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAPILLOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY EDEMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RIGHT VENTRICULAR HYPERTROPHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOOTH AGENESIS	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (338)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acanthosis Nigricans	Acanthosis Nigricans	BEFREE	1444575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acoustic Neuroma	Acoustic Neuroma	BEFREE	18199957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	7677980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10732760, 23030255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17922051, 18054376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	8358733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	22923609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	10963846, 27207663, 29662194, 30138108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	8669884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	17102096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	11568571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	18424623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	1697567, 8698313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	10861689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	22661255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	18790474, 29893310	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	25803032, 27583552, 30921351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	29554616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29554616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	11568571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	1512472, 8064230	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	2476168	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	31344532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	38253462	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11269942, 8494908, 8814167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Axenfeld-Rieger syndrome	Axenfeld anomaly	BEFREE	8266997		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29467862, 29667176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	1351861	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	8698313, 8973690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	38484669	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	10463465, 15589816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	11005785	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	19143022	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	2705509	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	7532545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10713694, 10713695, 11738552, 1664044, 18686047, 1922031, 19246968, 2043488, 20871631, 2331446, 2521857, 2524651, 2545892, 2607638, 2624883 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast Diseases	BEFREE	10713694, 29904427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	1320636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10903426, 11323501, 1711294, 17218988, 19749156, 23729230, 2521857, 25344915, 29581982, 30279141, 30916164, 8390290, 9667651	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	17468132, 24595367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	3863708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Head	Neoplasm of head	CTD_human_DG	15342401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Neck	Neck Cancer	CTD_human_DG	15342401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19124482, 22700631, 24133589, 28239819, 29581982, 7819044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11721445, 1317752, 1516034, 15642791, 2108945, 2157713, 2285597, 2298497, 2354442, 2696564, 2925270, 3467839, 7508078, 7852516, 8166440 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	1519669	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	3279155	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15040026, 19321179, 22700631, 28456666, 35007301	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	16581947, 27046040	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	10463465, 15589816, 8045915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	11721445, 1516034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26682573, 29662194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	11171960, 12944410, 15956968, 19052740, 34399807, 8886918	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	10428482, 1337797, 1503897, 1663788, 9828815	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	2002254	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10952922, 1457511, 9605408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	27701424	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	10502054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	22136669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	22136669	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	30834805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	17272867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30834805		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	9259394		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28315313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	9850316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	31125781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	34550531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	7988452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	25410537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	25410537, 28249836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	28473708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	8850247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	22104252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	16610058, 26279457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	10778984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	1352354, 1361101, 19444471, 7977355, 8105683, 8644715	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	1361101, 15054400, 15643916, 15965987, 17272867, 18956930, 23940636, 24243742, 7834275, 7977355, 8096116, 8105683, 9097091, 9181353, 9450887, 9610799, 9676424 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	1346481, 1352355, 19444471, 23940636, 24007308, 2570526, 7485164, 7977355, 8105683, 8554055	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	9610799	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	37686198	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11112342, 1399125, 1715580, 1732118, 2365825, 24023735, 2887281, 30392905, 7822434, 9335455, 9935234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	12657625, 15943034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	1696954, 1698444, 2365825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24520077, 30010111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11857296, 12657625, 15304500, 1558785, 19124482, 2365825, 24023735, 24114668, 24166893, 24916700, 31133691, 31253868	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	19276250, 30499618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	14714133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of lung	Pulmonary hypoplasia	BEFREE	14714133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11171960, 15964822, 1596891, 17206887, 18243508, 2354442, 2488683, 6088071, 7937720, 8560658, 8886918, 9187911, 9443397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	7554921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	2902017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	16134726, 17968906, 28777012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	GWASCAT_DG	29559693, 30664745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29554616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	31009665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental absence of tooth	Anodontia	BEFREE	15329380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	24192345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	24192345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29959129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	37380899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28249836, 29385323, 29959129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	35506311	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	10415867, 29904427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	10415867, 29904427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal ulcer	Pubtator	9176072	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren Contracture	BEFREE	9120728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysmorphism	Dysmorphism	BEFREE	7702037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	7963661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	31009665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	1532902, 8049128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	11698343, 12469199, 16826583, 16962163, 1833051, 26843615, 9259394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	16826583, 8641991	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	8636651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	1457511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	1380804, 2004373, 2298497, 8491760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	1380804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	9400997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial medullary thyroid carcinoma	Medullary thyroid carcinoma	BEFREE	9247102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis of pancreas	Fibrosis Of Pancreas	BEFREE	10369712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	12960509, 21382168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	24192345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	11859273, 2702651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	LHGDN	11859273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	10732760	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	24520077	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11269942, 11778757, 1347915, 17972023, 21503892, 2908920, 8280494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21649900, 2705509	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11269942, 11778757, 1347915, 17972023, 21503892, 2908920, 8280494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10533724, 16424019, 18636433, 7532545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	15701286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	40322064	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	23155381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	1408194, 19843672, 8339264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	CTD_human_DG	15342401		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	20443891	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head Neoplasms	Head Neoplasms	CTD_human_DG	15342401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	7639324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	16610058	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	CTD_human_DG	11560253		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatoblastoma	Hepatoblastoma	BEFREE	1328501		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	35290621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	15723263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	9820173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform mole	Pubtator	11737472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypereosinophilic syndrome	Hypereosinophilic Syndrome	BEFREE	1696954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	1696954	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperkeratosis Epidermolytic	Epidermolytic hyperkeratosis	Pubtator	2002254	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Secondary	Hyperparathyroidism	BEFREE	18216322, 25294851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	21505178	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	12896876, 17496152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypodontia	Hypodontia	ORPHANET_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypodontia	Hypodontia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplasia of the maxilla	Hypoplasia of the maxilla	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothalamic hamartomas	Hypothalamic Hamartomas	BEFREE	28591479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	11171960, 22863020	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19328625, 29482638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Hypereosinophilic Syndrome	Hypereosinophilic Syndrome	BEFREE	1696954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	17496152, 31156440		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	7870340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	24378596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	12032865		★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	8712689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28243165, 30834805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Jaundice, Obstructive	Jaundice	BEFREE	8760011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile polyposis syndrome	Polyposis Syndrome	BEFREE	22748914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	19535569, 28249836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	19535569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	25410537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	19052740, 2720695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	19052740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	34399807	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	26984929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	26984929	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	15864136, 2022775, 2752531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10374394, 10964327, 11952158, 12619035, 1328501, 17680562, 17698969, 18579559, 19034960, 19780938, 20020490, 21771728, 24486412, 26279457, 27046040 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12619035, 15040026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	15565109, 9029167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	16610058, 26279457, 7539239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	LHGDN	18507100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	22700631	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	15040026	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	11212255, 7539239, 9815784		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	CTD_human_DG	8807143		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	BEFREE	19188657, 28473708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	24819665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	1299622, 1337797	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	18811692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	29662194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	10732760, 24133589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	8850247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	10533724, 2165797, 2454731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	1408194, 19843672, 8339264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	CTD_human_DG	15342401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10713694, 11738552, 11778757, 1664044, 17218988, 17962208, 18686047, 1922031, 19246968, 2043488, 20871631, 2285595, 2331446, 2521857, 2524651 View all (16 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	11698343, 12469199, 16826583, 16962163, 1833051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	1380804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	24520077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	18243508, 19052740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	18579559, 20020490, 21771728, 24806597, 9270035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	8807143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10963846, 26682573, 29662194, 9290266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	15864136, 2022775, 2752531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10952922, 12370739, 1515265, 2696564, 9605408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11159909, 12120215, 1401070, 20473331, 29125273, 30921351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12665682, 15579918, 21887406, 22469032, 23460133, 24969691, 8698313, 9232607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17136230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11421874, 11535962, 1850725, 23995782, 24237184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	15723263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	10463465, 15589816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10778728, 11127578, 11568571, 11753991, 1696473, 17234777, 20020490, 20068146, 2266459, 2285595, 24237184, 24313652, 24685520, 24969691, 2696564 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	18650488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11112342, 1715580, 1732118, 2365825, 24023735, 2887281, 2925270, 30392905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	BEFREE	1922084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10882298, 10931950, 2043488, 23729230, 2624883, 26561468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17962208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	9247102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	15580309, 2736210, 33916908, 7963661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	2056188, 7578983, 7648437, 7963661, 8959342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	10778728, 28367377, 7532545, 8568531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29554616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	14692808, 7947089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	7947089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	14692808, 15756029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microdontia (disorder)	Microdontia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	11568571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	30948485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29769726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	23995279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	28045063	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	CTD_human_DG	15342401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10228902, 10362145, 10424781, 10449972, 10463465, 10621852, 10713694, 10713695, 10778728, 10778984, 10882298, 10952922, 11053991, 11127578, 11127817 View all (87 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	11753991, 26371248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	26984929	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	12709435, 18927293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	18927293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	14616544, 14713256, 7860139		★★★★★ ★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	18650488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	18650488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10209964, 21255411, 21528670, 24133589, 24378285, 27923629, 28239819, 7683573, 8382008, 8956792, 9815714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	16230376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nongerminomatous Germ Cell Tumor	Nongerminomatous Tumor	BEFREE	11555591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonsyndromic Deafness	Nonsyndromic Deafness	CTD_human_DG	27356075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligodontia	Oligodontia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligodontia	Oligodontia	ORPHANET_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral cleft	Oral cleft	BEFREE	22892881, 9345615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Orofacial cleft	Orofacial Cleft	BEFREE	9676424		★★★★★ ★☆☆☆☆ Found in Text Mining only
OROFACIAL CLEFT 1	Orofacial Cleft	BEFREE	10552925, 17272867, 23029012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Orofacial Cleft 1	Orofacial cleft	Pubtator	1352354, 19444471, 19937600, 23940636, 9610799	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	27701424, 33055079	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	28777012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	GWASCAT_DG	30374069, 30664745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	17968906, 28777012		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis, Knee	Knee osteoarthritis	GWASCAT_DG	30664745		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	BEFREE	23631646, 24023735, 24685520, 26708425, 27458156, 29125885, 29441940, 29928390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	27458156, 32020849	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
OTOFACIOCERVICAL SYNDROME 1	Otofaciocervical Syndrome	BEFREE	17272867		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10952922, 9605408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10081495, 10098742, 10811499, 29482638, 8695362	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pachyonychia Congenita	Pachyonychia congenita	Pubtator	36116508	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10374398, 11159909, 12120215, 1401070, 1886882, 20473331, 29125273, 30921351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	25803032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	11756558, 14506698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23426533, 23608755, 23764046, 33661995, 8260363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	9665487	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	23608755	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	29125273, 7959207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	1697567, 20877637, 21240064, 30540564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	10569807, 1709129		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papilloma	Papilloma	CTD_human_DG	8603490		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papilloma, Squamous Cell	Papilloma	CTD_human_DG	8603490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillomatosis	Papillomatosis	CTD_human_DG	8603490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid hyperplasia	Parathyroid hyperplasia	BEFREE	14730505, 18216322, 25294851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	37834363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	17102096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	8636651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	1739078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	BEFREE	9122266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12665682, 15579918, 21887406, 22469032, 23460133, 24969691, 8698313, 9232607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10360641, 19143022, 22469032, 36623397	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17136230		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	17917084, 21302606		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	26279457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	11173656, 2002254	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	1512472, 27185339, 8064230	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	1677800, 1702929, 1709129, 2380581, 8064230, 8980296, 9410906		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	CTD_human_DG	7519033		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychotic disorders	Pubtator	25970596	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21861887, 22701684	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	11597899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	17496152, 19244201, 20676040, 22021337, 24508732, 30730810, 31156440, 8879184		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	18424623		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pustulosis of Palms and Soles	Palmoplantar Pustules	CTD_human_DG	7519033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyloric Stenosis, Hypertrophic	Congenital hypertrophic pyloric stenosis	BEFREE	10370022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	8247529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	18243508, 19052740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15964822, 1596891, 17206887, 19052740, 2354442, 2488683, 6088071, 7937720, 8560658, 8886918, 9187911, 9820173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	11267936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid tumor	Pubtator	11267936	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	7577472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16134726, 8247529		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rieger syndrome	Rieger syndrome	BEFREE	8266997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	CTD_human_DG	18424623		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	BEFREE	1697567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	24743863	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	23099994, 24114668, 25520391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	17267001, 3279155	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	2002254	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	18329192, 9767281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	1337797	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10428482, 1463117, 2752531, 9513046, 9815714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12607604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	10938383, 8142616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	1696954, 20927317, 2478181, 28723928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	10851047, 11127578, 18316548, 19539778, 20693797, 28723928, 8339264, 8826952, 9242377, 9513046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	21382168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11421874, 11535962, 23995782, 24237184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach Diseases	BEFREE	22711003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	15723263		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	17922051, 2108945, 2168868, 31151932	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Synovitis	Synovitis	BEFREE	16134726		★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	15589816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	20877637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
THYROID CARCINOMA, SPORADIC MEDULLARY	Thyroid Carcinoma	BEFREE	9247102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	12733712	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	12733712	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	34067581	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	23729230, 30034618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	23729230	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Truncus Arteriosus, Persistent	Persistent truncus arteriosus	BEFREE	16469638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	8613031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Upper Aerodigestive Tract Neoplasms	Upper Aerodigestive Tract Neoplasms	CTD_human_DG	15342401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	10552925, 14639706, 15643916, 17272867, 18956930, 19444471, 23742131, 24007308, 24243742, 7702037, 8105683, 9003904, 9254850, 9265696, 9927220, 9988882 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	17267001	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	12896876, 8623164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	11171960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	21594709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TGFA (transforming growth factor alpha)