Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7037
Gene name	Transferrin receptor
Gene symbol	TFRC
Synonyms (NCBI Gene)	CD71IMD46T9TFRTFR1TRTRFRp90
Chromosome	3
Chromosome location	3q29
Summary	This gene encodes a cell surface receptor necessary for cellular iron uptake by the process of receptor-mediated endocytosis. This receptor is required for erythropoiesis and neurologic development. Multiple alternatively spliced variants have been identi

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs863225436	A>G	Conflicting-interpretations-of-pathogenicity, pathogenic	Missense variant, intron variant, non coding transcript variant, coding sequence variant
rs1341988492	C>A	Pathogenic	Splice donor variant

1084

Show/Hide all (1084)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003744	hsa-miR-320a	Luciferase reporter assay	18523662
MIRT003744	hsa-miR-320a	Luciferase reporter assay	19164563
MIRT003744	hsa-miR-320a	Luciferase reporter assay	18523662
MIRT003744	hsa-miR-320a	Luciferase reporter assay	19135902
MIRT004538	hsa-miR-22-3p	Luciferase reporter assay	19135902
MIRT004538	hsa-miR-22-3p	Northern blot	19135902
MIRT004549	hsa-miR-200a-3p	Northern blot	19135902
MIRT003744	hsa-miR-320a	Northern blot	19135902
MIRT003744	hsa-miR-320a	Luciferase reporter assay	19135902
MIRT004538	hsa-miR-22-3p	Luciferase reporter assay	19135902
MIRT003744	hsa-miR-320a	flow	19135902
MIRT004538	hsa-miR-22-3p	flow	19135902
MIRT003744	hsa-miR-320a	Review	20029422
MIRT003744	hsa-miR-320a	flowLuciferase reporter assayNorthern blot	19135902
MIRT004538	hsa-miR-22-3p	Luciferase reporter assayNorthern blot	19135902
MIRT006830	hsa-miR-210-3p	ImmunoblotImmunohistochemistryLuciferase reporter assayqRT-PCR	22896707
MIRT025450	hsa-miR-34a-5p	Proteomics	21566225
MIRT051253	hsa-miR-16-5p	CLASH	23622248
MIRT045700	hsa-miR-125a-5p	CLASH	23622248
MIRT039196	hsa-miR-769-5p	CLASH	23622248
MIRT053371	hsa-miR-9-5p	MicroarrayqRT-PCR	23798388
MIRT715982	hsa-miR-216b-3p	HITS-CLIP	19536157
MIRT715980	hsa-miR-4722-3p	HITS-CLIP	19536157
MIRT715981	hsa-miR-6727-3p	HITS-CLIP	19536157
MIRT715979	hsa-miR-6747-3p	HITS-CLIP	19536157
MIRT715978	hsa-miR-6070	HITS-CLIP	19536157
MIRT715977	hsa-miR-342-3p	HITS-CLIP	19536157
MIRT162080	hsa-miR-6895-3p	HITS-CLIP	19536157
MIRT715976	hsa-miR-3074-5p	HITS-CLIP	19536157
MIRT237313	hsa-miR-4733-5p	HITS-CLIP	23313552
MIRT698548	hsa-miR-6729-3p	HITS-CLIP	23313552
MIRT698547	hsa-miR-4670-5p	HITS-CLIP	23313552
MIRT698546	hsa-miR-4705	HITS-CLIP	23313552
MIRT698545	hsa-miR-3183	HITS-CLIP	23313552
MIRT698544	hsa-miR-4723-3p	HITS-CLIP	23313552
MIRT698543	hsa-miR-6769b-3p	HITS-CLIP	23313552
MIRT698542	hsa-miR-3664-3p	HITS-CLIP	23313552
MIRT698541	hsa-miR-3158-5p	HITS-CLIP	23313552
MIRT698540	hsa-miR-17-3p	HITS-CLIP	23313552
MIRT698539	hsa-miR-6821-3p	HITS-CLIP	23313552
MIRT698538	hsa-miR-4252	HITS-CLIP	23313552
MIRT698537	hsa-miR-1227-3p	HITS-CLIP	23313552
MIRT162042	hsa-miR-7111-3p	HITS-CLIP	23313552
MIRT698536	hsa-miR-1301-3p	HITS-CLIP	23313552
MIRT698535	hsa-miR-5047	HITS-CLIP	23313552
MIRT698534	hsa-miR-375	HITS-CLIP	23313552
MIRT162078	hsa-miR-6856-3p	HITS-CLIP	23313552
MIRT698533	hsa-miR-875-3p	HITS-CLIP	23313552
MIRT698532	hsa-miR-6128	HITS-CLIP	23313552
MIRT698531	hsa-miR-3185	HITS-CLIP	23313552
MIRT698530	hsa-miR-4468	HITS-CLIP	23313552
MIRT698529	hsa-miR-1299	HITS-CLIP	23313552
MIRT698528	hsa-miR-7-5p	HITS-CLIP	23313552
MIRT698527	hsa-miR-656-3p	HITS-CLIP	23313552
MIRT306692	hsa-miR-126-5p	HITS-CLIP	23313552
MIRT698526	hsa-miR-3622a-3p	HITS-CLIP	23313552
MIRT698525	hsa-miR-3622b-3p	HITS-CLIP	23313552
MIRT162005	hsa-miR-130b-5p	HITS-CLIP	23313552
MIRT162006	hsa-miR-302b-5p	HITS-CLIP	23313552
MIRT162007	hsa-miR-302d-5p	HITS-CLIP	23313552
MIRT698524	hsa-miR-4738-3p	HITS-CLIP	23313552
MIRT698523	hsa-miR-924	HITS-CLIP	23313552
MIRT698522	hsa-miR-1251-3p	HITS-CLIP	23313552
MIRT162043	hsa-miR-182-3p	HITS-CLIP	23313552
MIRT162051	hsa-miR-597-3p	HITS-CLIP	23313552
MIRT162045	hsa-miR-152-5p	HITS-CLIP	23313552
MIRT698521	hsa-miR-636	HITS-CLIP	23313552
MIRT698520	hsa-miR-2117	HITS-CLIP	23313552
MIRT698519	hsa-miR-4795-3p	HITS-CLIP	23313552
MIRT390034	hsa-miR-4753-3p	HITS-CLIP	23313552
MIRT698518	hsa-miR-627-5p	HITS-CLIP	23313552
MIRT306711	hsa-miR-6079	HITS-CLIP	23313552
MIRT698517	hsa-miR-218-5p	HITS-CLIP	23313552
MIRT698516	hsa-miR-6809-3p	HITS-CLIP	23313552
MIRT439469	ebv-miR-BART10-3p	HITS-CLIP	22473208
MIRT439468	hsa-miR-136-5p	HITS-CLIP	24374217
MIRT006830	hsa-miR-210-3p	HITS-CLIP	22473208
MIRT439469	ebv-miR-BART10-3p	HITS-CLIP	22473208
MIRT439468	hsa-miR-136-5p	HITS-CLIP	24374217
MIRT726333	hsa-miR-181a-5p	HITS-CLIP	22473208
MIRT726332	hsa-miR-181b-5p	HITS-CLIP	22473208
MIRT726330	hsa-miR-181c-5p	HITS-CLIP	22473208
MIRT726331	hsa-miR-181d-5p	HITS-CLIP	22473208
MIRT006830	hsa-miR-210-3p	HITS-CLIP	22473208
MIRT715982	hsa-miR-216b-3p	HITS-CLIP	19536157
MIRT715980	hsa-miR-4722-3p	HITS-CLIP	19536157
MIRT715981	hsa-miR-6727-3p	HITS-CLIP	19536157
MIRT715979	hsa-miR-6747-3p	HITS-CLIP	19536157
MIRT715978	hsa-miR-6070	HITS-CLIP	19536157
MIRT715977	hsa-miR-342-3p	HITS-CLIP	19536157
MIRT162080	hsa-miR-6895-3p	HITS-CLIP	19536157
MIRT715976	hsa-miR-3074-5p	HITS-CLIP	19536157
MIRT237313	hsa-miR-4733-5p	HITS-CLIP	23313552
MIRT698548	hsa-miR-6729-3p	HITS-CLIP	23313552
MIRT698547	hsa-miR-4670-5p	HITS-CLIP	23313552
MIRT698546	hsa-miR-4705	HITS-CLIP	23313552
MIRT698545	hsa-miR-3183	HITS-CLIP	23313552
MIRT698544	hsa-miR-4723-3p	HITS-CLIP	23313552
MIRT698543	hsa-miR-6769b-3p	HITS-CLIP	23313552
MIRT698542	hsa-miR-3664-3p	HITS-CLIP	23313552
MIRT698541	hsa-miR-3158-5p	HITS-CLIP	23313552
MIRT698540	hsa-miR-17-3p	HITS-CLIP	23313552
MIRT698539	hsa-miR-6821-3p	HITS-CLIP	23313552
MIRT698538	hsa-miR-4252	HITS-CLIP	23313552
MIRT698537	hsa-miR-1227-3p	HITS-CLIP	23313552
MIRT162042	hsa-miR-7111-3p	HITS-CLIP	23313552
MIRT698536	hsa-miR-1301-3p	HITS-CLIP	23313552
MIRT698535	hsa-miR-5047	HITS-CLIP	23313552
MIRT698534	hsa-miR-375	HITS-CLIP	23313552
MIRT162078	hsa-miR-6856-3p	HITS-CLIP	23313552
MIRT698533	hsa-miR-875-3p	HITS-CLIP	23313552
MIRT698532	hsa-miR-6128	HITS-CLIP	23313552
MIRT698531	hsa-miR-3185	HITS-CLIP	23313552
MIRT698530	hsa-miR-4468	HITS-CLIP	23313552
MIRT698529	hsa-miR-1299	HITS-CLIP	23313552
MIRT698528	hsa-miR-7-5p	HITS-CLIP	23313552
MIRT698527	hsa-miR-656-3p	HITS-CLIP	23313552
MIRT306692	hsa-miR-126-5p	HITS-CLIP	23313552
MIRT698526	hsa-miR-3622a-3p	HITS-CLIP	23313552
MIRT698525	hsa-miR-3622b-3p	HITS-CLIP	23313552
MIRT162005	hsa-miR-130b-5p	HITS-CLIP	23313552
MIRT162006	hsa-miR-302b-5p	HITS-CLIP	23313552
MIRT162007	hsa-miR-302d-5p	HITS-CLIP	23313552
MIRT698524	hsa-miR-4738-3p	HITS-CLIP	23313552
MIRT698523	hsa-miR-924	HITS-CLIP	23313552
MIRT698522	hsa-miR-1251-3p	HITS-CLIP	23313552
MIRT162043	hsa-miR-182-3p	HITS-CLIP	23313552
MIRT162051	hsa-miR-597-3p	HITS-CLIP	23313552
MIRT162045	hsa-miR-152-5p	HITS-CLIP	23313552
MIRT698521	hsa-miR-636	HITS-CLIP	23313552
MIRT698520	hsa-miR-2117	HITS-CLIP	23313552
MIRT698519	hsa-miR-4795-3p	HITS-CLIP	23313552
MIRT390034	hsa-miR-4753-3p	HITS-CLIP	23313552
MIRT698518	hsa-miR-627-5p	HITS-CLIP	23313552
MIRT306711	hsa-miR-6079	HITS-CLIP	23313552
MIRT698517	hsa-miR-218-5p	HITS-CLIP	23313552
MIRT698516	hsa-miR-6809-3p	HITS-CLIP	23313552
MIRT755788	miR-370	Luciferase reporter assayWestern blottingqRT-PCR	35611986
MIRT1420695	hsa-miR-105	CLIP-seq
MIRT1420696	hsa-miR-10a	CLIP-seq
MIRT1420697	hsa-miR-10b	CLIP-seq
MIRT1420698	hsa-miR-1179	CLIP-seq
MIRT1420699	hsa-miR-1208	CLIP-seq
MIRT1420700	hsa-miR-1243	CLIP-seq
MIRT1420701	hsa-miR-1245b-5p	CLIP-seq
MIRT1420702	hsa-miR-1253	CLIP-seq
MIRT1420703	hsa-miR-1261	CLIP-seq
MIRT1420704	hsa-miR-1264	CLIP-seq
MIRT1420705	hsa-miR-1267	CLIP-seq
MIRT1420706	hsa-miR-1270	CLIP-seq
MIRT1420707	hsa-miR-1273g	CLIP-seq
MIRT1420708	hsa-miR-1276	CLIP-seq
MIRT1420709	hsa-miR-1286	CLIP-seq
MIRT1420710	hsa-miR-129-3p	CLIP-seq
MIRT1420711	hsa-miR-1297	CLIP-seq
MIRT1420712	hsa-miR-1305	CLIP-seq
MIRT1420713	hsa-miR-1323	CLIP-seq
MIRT1420714	hsa-miR-1324	CLIP-seq
MIRT1420715	hsa-miR-136	CLIP-seq
MIRT1420716	hsa-miR-140-3p	CLIP-seq
MIRT1420717	hsa-miR-140-5p	CLIP-seq
MIRT1420718	hsa-miR-145	CLIP-seq
MIRT1420719	hsa-miR-148a	CLIP-seq
MIRT1420720	hsa-miR-148b	CLIP-seq
MIRT1420721	hsa-miR-152	CLIP-seq
MIRT1420722	hsa-miR-181a	CLIP-seq
MIRT1420723	hsa-miR-181b	CLIP-seq
MIRT1420724	hsa-miR-181c	CLIP-seq
MIRT1420725	hsa-miR-181d	CLIP-seq
MIRT1420726	hsa-miR-182	CLIP-seq
MIRT1420727	hsa-miR-1827	CLIP-seq
MIRT1420728	hsa-miR-1910	CLIP-seq
MIRT1420729	hsa-miR-214	CLIP-seq
MIRT1420730	hsa-miR-216a	CLIP-seq
MIRT1420731	hsa-miR-217	CLIP-seq
MIRT1420732	hsa-miR-221	CLIP-seq
MIRT1420733	hsa-miR-222	CLIP-seq
MIRT1420734	hsa-miR-223	CLIP-seq
MIRT1420735	hsa-miR-2276	CLIP-seq
MIRT1420736	hsa-miR-23a	CLIP-seq
MIRT1420737	hsa-miR-23b	CLIP-seq
MIRT1420738	hsa-miR-23c	CLIP-seq
MIRT1420739	hsa-miR-2467-5p	CLIP-seq
MIRT1420740	hsa-miR-2682	CLIP-seq
MIRT1420741	hsa-miR-26a	CLIP-seq
MIRT1420742	hsa-miR-26b	CLIP-seq
MIRT1420743	hsa-miR-28-5p	CLIP-seq
MIRT1420744	hsa-miR-298	CLIP-seq
MIRT1420745	hsa-miR-300	CLIP-seq
MIRT1420746	hsa-miR-3065-3p	CLIP-seq
MIRT1420747	hsa-miR-31	CLIP-seq
MIRT1420748	hsa-miR-3115	CLIP-seq
MIRT1420749	hsa-miR-3117-5p	CLIP-seq
MIRT1420750	hsa-miR-3126-3p	CLIP-seq
MIRT1420751	hsa-miR-3139	CLIP-seq
MIRT1420752	hsa-miR-3142	CLIP-seq
MIRT1420753	hsa-miR-3143	CLIP-seq
MIRT1420754	hsa-miR-3147	CLIP-seq
MIRT1420755	hsa-miR-3159	CLIP-seq
MIRT1420756	hsa-miR-3160-5p	CLIP-seq
MIRT1420757	hsa-miR-3161	CLIP-seq
MIRT1420758	hsa-miR-3163	CLIP-seq
MIRT1420759	hsa-miR-3168	CLIP-seq
MIRT1420760	hsa-miR-3188	CLIP-seq
MIRT1420761	hsa-miR-330-3p	CLIP-seq
MIRT1420762	hsa-miR-338-3p	CLIP-seq
MIRT1420763	hsa-miR-3606	CLIP-seq
MIRT1420764	hsa-miR-3607-3p	CLIP-seq
MIRT1420765	hsa-miR-3617	CLIP-seq
MIRT1420766	hsa-miR-3619-5p	CLIP-seq
MIRT1420767	hsa-miR-3646	CLIP-seq
MIRT1420768	hsa-miR-3647-3p	CLIP-seq
MIRT1420769	hsa-miR-3654	CLIP-seq
MIRT1420770	hsa-miR-3660	CLIP-seq
MIRT1420771	hsa-miR-3663-5p	CLIP-seq
MIRT1420772	hsa-miR-3671	CLIP-seq
MIRT1420773	hsa-miR-3674	CLIP-seq
MIRT1420774	hsa-miR-3688-3p	CLIP-seq
MIRT1420775	hsa-miR-370	CLIP-seq
MIRT1420776	hsa-miR-374a	CLIP-seq
MIRT1420777	hsa-miR-374b	CLIP-seq
MIRT1420778	hsa-miR-381	CLIP-seq
MIRT1420779	hsa-miR-3919	CLIP-seq
MIRT1420780	hsa-miR-3940-5p	CLIP-seq
MIRT1420781	hsa-miR-3942-3p	CLIP-seq
MIRT1420782	hsa-miR-3973	CLIP-seq
MIRT1420783	hsa-miR-3974	CLIP-seq
MIRT1420784	hsa-miR-3975	CLIP-seq
MIRT1420785	hsa-miR-3978	CLIP-seq
MIRT1420786	hsa-miR-421	CLIP-seq
MIRT1420787	hsa-miR-425	CLIP-seq
MIRT1420788	hsa-miR-4256	CLIP-seq
MIRT1420789	hsa-miR-4262	CLIP-seq
MIRT1420790	hsa-miR-4264	CLIP-seq
MIRT1420791	hsa-miR-4266	CLIP-seq
MIRT1420792	hsa-miR-4273	CLIP-seq
MIRT1420793	hsa-miR-4281	CLIP-seq
MIRT1420794	hsa-miR-4282	CLIP-seq
MIRT1420795	hsa-miR-4291	CLIP-seq
MIRT1420796	hsa-miR-4310	CLIP-seq
MIRT1420797	hsa-miR-4316	CLIP-seq
MIRT1420798	hsa-miR-4317	CLIP-seq
MIRT1420799	hsa-miR-4420	CLIP-seq
MIRT1420800	hsa-miR-4425	CLIP-seq
MIRT1420801	hsa-miR-4433	CLIP-seq
MIRT1420802	hsa-miR-4434	CLIP-seq
MIRT1420803	hsa-miR-4443	CLIP-seq
MIRT1420804	hsa-miR-4452	CLIP-seq
MIRT1420805	hsa-miR-4465	CLIP-seq
MIRT1420806	hsa-miR-4477a	CLIP-seq
MIRT1420807	hsa-miR-449c	CLIP-seq
MIRT1420808	hsa-miR-4504	CLIP-seq
MIRT1420809	hsa-miR-4507	CLIP-seq
MIRT1420810	hsa-miR-450b-5p	CLIP-seq
MIRT1420811	hsa-miR-4511	CLIP-seq
MIRT1420812	hsa-miR-4516	CLIP-seq
MIRT1420813	hsa-miR-4526	CLIP-seq
MIRT1420814	hsa-miR-4530	CLIP-seq
MIRT1420815	hsa-miR-4531	CLIP-seq
MIRT1420816	hsa-miR-455-3p	CLIP-seq
MIRT1420817	hsa-miR-4637	CLIP-seq
MIRT1420818	hsa-miR-4662a-3p	CLIP-seq
MIRT1420819	hsa-miR-4666-3p	CLIP-seq
MIRT1420820	hsa-miR-4670-3p	CLIP-seq
MIRT1420821	hsa-miR-4684-3p	CLIP-seq
MIRT1420822	hsa-miR-4695-3p	CLIP-seq
MIRT1420823	hsa-miR-4695-5p	CLIP-seq
MIRT1420824	hsa-miR-4697-3p	CLIP-seq
MIRT1420825	hsa-miR-4698	CLIP-seq
MIRT1420826	hsa-miR-4699-5p	CLIP-seq
MIRT1420827	hsa-miR-4709-3p	CLIP-seq
MIRT1420828	hsa-miR-4709-5p	CLIP-seq
MIRT1420829	hsa-miR-4712-5p	CLIP-seq
MIRT1420830	hsa-miR-4714-3p	CLIP-seq
MIRT1420831	hsa-miR-4720-3p	CLIP-seq
MIRT1420832	hsa-miR-4722-5p	CLIP-seq
MIRT1420833	hsa-miR-4724-5p	CLIP-seq
MIRT1420834	hsa-miR-4729	CLIP-seq
MIRT1420835	hsa-miR-4753-5p	CLIP-seq
MIRT1420836	hsa-miR-4756-3p	CLIP-seq
MIRT1420837	hsa-miR-4760-3p	CLIP-seq
MIRT1420838	hsa-miR-4762-3p	CLIP-seq
MIRT1420839	hsa-miR-4766-3p	CLIP-seq
MIRT1420840	hsa-miR-4772-3p	CLIP-seq
MIRT1420841	hsa-miR-4774-5p	CLIP-seq
MIRT1420842	hsa-miR-4777-5p	CLIP-seq
MIRT1420843	hsa-miR-4779	CLIP-seq
MIRT1420844	hsa-miR-4786-5p	CLIP-seq
MIRT1420845	hsa-miR-4789-5p	CLIP-seq
MIRT1420846	hsa-miR-4797-3p	CLIP-seq
MIRT1420847	hsa-miR-4798-3p	CLIP-seq
MIRT1420848	hsa-miR-4803	CLIP-seq
MIRT1420849	hsa-miR-4804-3p	CLIP-seq
MIRT1420850	hsa-miR-485-5p	CLIP-seq
MIRT1420851	hsa-miR-490-3p	CLIP-seq
MIRT1420852	hsa-miR-490-5p	CLIP-seq
MIRT1420853	hsa-miR-493	CLIP-seq
MIRT1420854	hsa-miR-498	CLIP-seq
MIRT1420855	hsa-miR-507	CLIP-seq
MIRT1420856	hsa-miR-5096	CLIP-seq
MIRT1420857	hsa-miR-513a-3p	CLIP-seq
MIRT1420858	hsa-miR-513c	CLIP-seq
MIRT1420859	hsa-miR-514b-5p	CLIP-seq
MIRT1420860	hsa-miR-518a-5p	CLIP-seq
MIRT1420861	hsa-miR-518d-5p	CLIP-seq
MIRT1420862	hsa-miR-519b-5p	CLIP-seq
MIRT1420863	hsa-miR-519c-5p	CLIP-seq
MIRT1420864	hsa-miR-520c-5p	CLIP-seq
MIRT1420865	hsa-miR-520d-5p	CLIP-seq
MIRT1420866	hsa-miR-520g	CLIP-seq
MIRT1420867	hsa-miR-520h	CLIP-seq
MIRT1420868	hsa-miR-524-5p	CLIP-seq
MIRT1420869	hsa-miR-526a	CLIP-seq
MIRT1420870	hsa-miR-527	CLIP-seq
MIRT1420871	hsa-miR-542-3p	CLIP-seq
MIRT1420872	hsa-miR-543	CLIP-seq
MIRT1420873	hsa-miR-544	CLIP-seq
MIRT1420874	hsa-miR-548a-3p	CLIP-seq
MIRT1420875	hsa-miR-548a-5p	CLIP-seq
MIRT1420876	hsa-miR-548ab	CLIP-seq
MIRT1420877	hsa-miR-548ak	CLIP-seq
MIRT1420878	hsa-miR-548b-3p	CLIP-seq
MIRT1420879	hsa-miR-548b-5p	CLIP-seq
MIRT1420880	hsa-miR-548c-5p	CLIP-seq
MIRT1420881	hsa-miR-548d-5p	CLIP-seq
MIRT1420882	hsa-miR-548e	CLIP-seq
MIRT1420883	hsa-miR-548f	CLIP-seq
MIRT1420884	hsa-miR-548g	CLIP-seq
MIRT1420885	hsa-miR-548h	CLIP-seq
MIRT1420886	hsa-miR-548i	CLIP-seq
MIRT1420887	hsa-miR-548j	CLIP-seq
MIRT1420888	hsa-miR-548m	CLIP-seq
MIRT1420889	hsa-miR-548o	CLIP-seq
MIRT1420890	hsa-miR-548w	CLIP-seq
MIRT1420891	hsa-miR-548y	CLIP-seq
MIRT1420892	hsa-miR-557	CLIP-seq
MIRT1420893	hsa-miR-559	CLIP-seq
MIRT1420894	hsa-miR-563	CLIP-seq
MIRT1420895	hsa-miR-570	CLIP-seq
MIRT1420896	hsa-miR-579	CLIP-seq
MIRT1420897	hsa-miR-582-3p	CLIP-seq
MIRT1420898	hsa-miR-582-5p	CLIP-seq
MIRT1420899	hsa-miR-583	CLIP-seq
MIRT1420900	hsa-miR-591	CLIP-seq
MIRT1420901	hsa-miR-595	CLIP-seq
MIRT1420902	hsa-miR-607	CLIP-seq
MIRT1420903	hsa-miR-610	CLIP-seq
MIRT1420904	hsa-miR-616	CLIP-seq
MIRT1420905	hsa-miR-620	CLIP-seq
MIRT1420906	hsa-miR-629	CLIP-seq
MIRT1420907	hsa-miR-634	CLIP-seq
MIRT1420908	hsa-miR-641	CLIP-seq
MIRT1420909	hsa-miR-642b	CLIP-seq
MIRT1420910	hsa-miR-651	CLIP-seq
MIRT1420911	hsa-miR-664	CLIP-seq
MIRT1420912	hsa-miR-665	CLIP-seq
MIRT1420913	hsa-miR-668	CLIP-seq
MIRT1420914	hsa-miR-671-5p	CLIP-seq
MIRT1420915	hsa-miR-708	CLIP-seq
MIRT1420916	hsa-miR-758	CLIP-seq
MIRT1420917	hsa-miR-761	CLIP-seq
MIRT1420918	hsa-miR-765	CLIP-seq
MIRT1420919	hsa-miR-770-5p	CLIP-seq
MIRT1420920	hsa-miR-885-5p	CLIP-seq
MIRT1420921	hsa-miR-888	CLIP-seq
MIRT1420922	hsa-miR-891b	CLIP-seq
MIRT1420923	hsa-miR-9	CLIP-seq
MIRT1420924	hsa-miR-922	CLIP-seq
MIRT1420925	hsa-miR-938	CLIP-seq
MIRT1420926	hsa-miR-103a	CLIP-seq
MIRT1420695	hsa-miR-105	CLIP-seq
MIRT1420927	hsa-miR-107	CLIP-seq
MIRT1420696	hsa-miR-10a	CLIP-seq
MIRT1420697	hsa-miR-10b	CLIP-seq
MIRT1420698	hsa-miR-1179	CLIP-seq
MIRT1420928	hsa-miR-1183	CLIP-seq
MIRT1420699	hsa-miR-1208	CLIP-seq
MIRT1420701	hsa-miR-1245b-5p	CLIP-seq
MIRT1420929	hsa-miR-1271	CLIP-seq
MIRT1420708	hsa-miR-1276	CLIP-seq
MIRT1420930	hsa-miR-1279	CLIP-seq
MIRT1420709	hsa-miR-1286	CLIP-seq
MIRT1420711	hsa-miR-1297	CLIP-seq
MIRT1420931	hsa-miR-1298	CLIP-seq
MIRT1420714	hsa-miR-1324	CLIP-seq
MIRT1420716	hsa-miR-140-3p	CLIP-seq
MIRT1420932	hsa-miR-141	CLIP-seq
MIRT1420719	hsa-miR-148a	CLIP-seq
MIRT1420720	hsa-miR-148b	CLIP-seq
MIRT1420721	hsa-miR-152	CLIP-seq
MIRT1420722	hsa-miR-181a	CLIP-seq
MIRT1420723	hsa-miR-181b	CLIP-seq
MIRT1420724	hsa-miR-181c	CLIP-seq
MIRT1420725	hsa-miR-181d	CLIP-seq
MIRT1420726	hsa-miR-182	CLIP-seq
MIRT1420727	hsa-miR-1827	CLIP-seq
MIRT1420933	hsa-miR-193a-3p	CLIP-seq
MIRT1420934	hsa-miR-193b	CLIP-seq
MIRT1420935	hsa-miR-197	CLIP-seq
MIRT1420936	hsa-miR-200a	CLIP-seq
MIRT1420937	hsa-miR-2116	CLIP-seq
MIRT1420731	hsa-miR-217	CLIP-seq
MIRT1420938	hsa-miR-2355-5p	CLIP-seq
MIRT1420736	hsa-miR-23a	CLIP-seq
MIRT1420737	hsa-miR-23b	CLIP-seq
MIRT1420738	hsa-miR-23c	CLIP-seq
MIRT1420739	hsa-miR-2467-5p	CLIP-seq
MIRT1420740	hsa-miR-2682	CLIP-seq
MIRT1420741	hsa-miR-26a	CLIP-seq
MIRT1420742	hsa-miR-26b	CLIP-seq
MIRT1420745	hsa-miR-300	CLIP-seq
MIRT1420748	hsa-miR-3115	CLIP-seq
MIRT1420749	hsa-miR-3117-5p	CLIP-seq
MIRT1420750	hsa-miR-3126-3p	CLIP-seq
MIRT1420939	hsa-miR-3127-5p	CLIP-seq
MIRT1420940	hsa-miR-3132	CLIP-seq
MIRT1420752	hsa-miR-3142	CLIP-seq
MIRT1420753	hsa-miR-3143	CLIP-seq
MIRT1420941	hsa-miR-3145-3p	CLIP-seq
MIRT1420942	hsa-miR-3152-3p	CLIP-seq
MIRT1420757	hsa-miR-3161	CLIP-seq
MIRT1420758	hsa-miR-3163	CLIP-seq
MIRT1420759	hsa-miR-3168	CLIP-seq
MIRT1420943	hsa-miR-3187-3p	CLIP-seq
MIRT1420760	hsa-miR-3188	CLIP-seq
MIRT1420944	hsa-miR-3200-3p	CLIP-seq
MIRT1420762	hsa-miR-338-3p	CLIP-seq
MIRT1420764	hsa-miR-3607-3p	CLIP-seq
MIRT1420767	hsa-miR-3646	CLIP-seq
MIRT1420770	hsa-miR-3660	CLIP-seq
MIRT1420771	hsa-miR-3663-5p	CLIP-seq
MIRT1420945	hsa-miR-3667-3p	CLIP-seq
MIRT1420946	hsa-miR-3675-3p	CLIP-seq
MIRT1420947	hsa-miR-3680	CLIP-seq
MIRT1420948	hsa-miR-3689a-5p	CLIP-seq
MIRT1420949	hsa-miR-3689b	CLIP-seq
MIRT1420950	hsa-miR-3689e	CLIP-seq
MIRT1420951	hsa-miR-3689f	CLIP-seq
MIRT1420775	hsa-miR-370	CLIP-seq
MIRT1420778	hsa-miR-381	CLIP-seq
MIRT1420952	hsa-miR-3915	CLIP-seq
MIRT1420953	hsa-miR-3926	CLIP-seq
MIRT1420954	hsa-miR-3928	CLIP-seq
MIRT1420782	hsa-miR-3973	CLIP-seq
MIRT1420783	hsa-miR-3974	CLIP-seq
MIRT1420784	hsa-miR-3975	CLIP-seq
MIRT1420786	hsa-miR-421	CLIP-seq
MIRT1420787	hsa-miR-425	CLIP-seq
MIRT1420789	hsa-miR-4262	CLIP-seq
MIRT1420790	hsa-miR-4264	CLIP-seq
MIRT1420791	hsa-miR-4266	CLIP-seq
MIRT1420955	hsa-miR-4272	CLIP-seq
MIRT1420792	hsa-miR-4273	CLIP-seq
MIRT1420956	hsa-miR-4275	CLIP-seq
MIRT1420794	hsa-miR-4282	CLIP-seq
MIRT1420957	hsa-miR-4286	CLIP-seq
MIRT1420796	hsa-miR-4310	CLIP-seq
MIRT1420958	hsa-miR-4311	CLIP-seq
MIRT1420797	hsa-miR-4316	CLIP-seq
MIRT1420959	hsa-miR-4318	CLIP-seq
MIRT1420799	hsa-miR-4420	CLIP-seq
MIRT1420801	hsa-miR-4433	CLIP-seq
MIRT1420960	hsa-miR-4435	CLIP-seq
MIRT1420803	hsa-miR-4443	CLIP-seq
MIRT1420961	hsa-miR-4461	CLIP-seq
MIRT1420805	hsa-miR-4465	CLIP-seq
MIRT1420962	hsa-miR-4476	CLIP-seq
MIRT1420806	hsa-miR-4477a	CLIP-seq
MIRT1420963	hsa-miR-4496	CLIP-seq
MIRT1420807	hsa-miR-449c	CLIP-seq
MIRT1420964	hsa-miR-4506	CLIP-seq
MIRT1420810	hsa-miR-450b-5p	CLIP-seq
MIRT1420811	hsa-miR-4511	CLIP-seq
MIRT1420965	hsa-miR-452	CLIP-seq
MIRT1420813	hsa-miR-4526	CLIP-seq
MIRT1420966	hsa-miR-4536	CLIP-seq
MIRT1420967	hsa-miR-4652-5p	CLIP-seq
MIRT1420819	hsa-miR-4666-3p	CLIP-seq
MIRT1420820	hsa-miR-4670-3p	CLIP-seq
MIRT1420968	hsa-miR-4676-3p	CLIP-seq
MIRT1420969	hsa-miR-4677-3p	CLIP-seq
MIRT1420970	hsa-miR-4677-5p	CLIP-seq
MIRT1420821	hsa-miR-4684-3p	CLIP-seq
MIRT1420971	hsa-miR-4687-3p	CLIP-seq
MIRT1420823	hsa-miR-4695-5p	CLIP-seq
MIRT1420824	hsa-miR-4697-3p	CLIP-seq
MIRT1420825	hsa-miR-4698	CLIP-seq
MIRT1420826	hsa-miR-4699-5p	CLIP-seq
MIRT1420972	hsa-miR-4701-5p	CLIP-seq
MIRT1420827	hsa-miR-4709-3p	CLIP-seq
MIRT1420828	hsa-miR-4709-5p	CLIP-seq
MIRT1420832	hsa-miR-4722-5p	CLIP-seq
MIRT1420835	hsa-miR-4753-5p	CLIP-seq
MIRT1420837	hsa-miR-4760-3p	CLIP-seq
MIRT1420838	hsa-miR-4762-3p	CLIP-seq
MIRT1420839	hsa-miR-4766-3p	CLIP-seq
MIRT1420842	hsa-miR-4777-5p	CLIP-seq
MIRT1420843	hsa-miR-4779	CLIP-seq
MIRT1420973	hsa-miR-4782-5p	CLIP-seq
MIRT1420845	hsa-miR-4789-5p	CLIP-seq
MIRT1420846	hsa-miR-4797-3p	CLIP-seq
MIRT1420974	hsa-miR-4799-5p	CLIP-seq
MIRT1420848	hsa-miR-4803	CLIP-seq
MIRT1420850	hsa-miR-485-5p	CLIP-seq
MIRT1420852	hsa-miR-490-5p	CLIP-seq
MIRT1420855	hsa-miR-507	CLIP-seq
MIRT1420975	hsa-miR-516b	CLIP-seq
MIRT1420861	hsa-miR-518d-5p	CLIP-seq
MIRT1420862	hsa-miR-519b-5p	CLIP-seq
MIRT1420863	hsa-miR-519c-5p	CLIP-seq
MIRT1420864	hsa-miR-520c-5p	CLIP-seq
MIRT1420865	hsa-miR-520d-5p	CLIP-seq
MIRT1420866	hsa-miR-520g	CLIP-seq
MIRT1420867	hsa-miR-520h	CLIP-seq
MIRT1420868	hsa-miR-524-5p	CLIP-seq
MIRT1420869	hsa-miR-526a	CLIP-seq
MIRT1420874	hsa-miR-548a-3p	CLIP-seq
MIRT1420875	hsa-miR-548a-5p	CLIP-seq
MIRT1420976	hsa-miR-548aa	CLIP-seq
MIRT1420876	hsa-miR-548ab	CLIP-seq
MIRT1420977	hsa-miR-548ac	CLIP-seq
MIRT1420978	hsa-miR-548ae	CLIP-seq
MIRT1420979	hsa-miR-548aj	CLIP-seq
MIRT1420877	hsa-miR-548ak	CLIP-seq
MIRT1420980	hsa-miR-548am	CLIP-seq
MIRT1420878	hsa-miR-548b-3p	CLIP-seq
MIRT1420879	hsa-miR-548b-5p	CLIP-seq
MIRT1420880	hsa-miR-548c-5p	CLIP-seq
MIRT1420981	hsa-miR-548d-3p	CLIP-seq
MIRT1420881	hsa-miR-548d-5p	CLIP-seq
MIRT1420882	hsa-miR-548e	CLIP-seq
MIRT1420883	hsa-miR-548f	CLIP-seq
MIRT1420884	hsa-miR-548g	CLIP-seq
MIRT1420885	hsa-miR-548h	CLIP-seq
MIRT1420886	hsa-miR-548i	CLIP-seq
MIRT1420887	hsa-miR-548j	CLIP-seq
MIRT1420888	hsa-miR-548m	CLIP-seq
MIRT1420982	hsa-miR-548s	CLIP-seq
MIRT1420890	hsa-miR-548w	CLIP-seq
MIRT1420983	hsa-miR-548x	CLIP-seq
MIRT1420891	hsa-miR-548y	CLIP-seq
MIRT1420984	hsa-miR-548z	CLIP-seq
MIRT1420892	hsa-miR-557	CLIP-seq
MIRT1420893	hsa-miR-559	CLIP-seq
MIRT1420896	hsa-miR-579	CLIP-seq
MIRT1420897	hsa-miR-582-3p	CLIP-seq
MIRT1420899	hsa-miR-583	CLIP-seq
MIRT1420985	hsa-miR-588	CLIP-seq
MIRT1420903	hsa-miR-610	CLIP-seq
MIRT1420907	hsa-miR-634	CLIP-seq
MIRT1420909	hsa-miR-642b	CLIP-seq
MIRT1420986	hsa-miR-647	CLIP-seq
MIRT1420910	hsa-miR-651	CLIP-seq
MIRT1420987	hsa-miR-656	CLIP-seq
MIRT1420914	hsa-miR-671-5p	CLIP-seq
MIRT1420918	hsa-miR-765	CLIP-seq
MIRT1420988	hsa-miR-873	CLIP-seq
MIRT1420989	hsa-miR-885-3p	CLIP-seq
MIRT1420920	hsa-miR-885-5p	CLIP-seq
MIRT1420921	hsa-miR-888	CLIP-seq
MIRT1420990	hsa-miR-892b	CLIP-seq
MIRT1420991	hsa-miR-940	CLIP-seq
MIRT1420992	hsa-miR-96	CLIP-seq
MIRT1420806	hsa-miR-4477a	CLIP-seq
MIRT1420897	hsa-miR-582-3p	CLIP-seq
MIRT1420696	hsa-miR-10a	CLIP-seq
MIRT1420697	hsa-miR-10b	CLIP-seq
MIRT1420699	hsa-miR-1208	CLIP-seq
MIRT1420701	hsa-miR-1245b-5p	CLIP-seq
MIRT1420711	hsa-miR-1297	CLIP-seq
MIRT1420722	hsa-miR-181a	CLIP-seq
MIRT1420723	hsa-miR-181b	CLIP-seq
MIRT1420724	hsa-miR-181c	CLIP-seq
MIRT1420725	hsa-miR-181d	CLIP-seq
MIRT1420726	hsa-miR-182	CLIP-seq
MIRT2126330	hsa-miR-218	CLIP-seq
MIRT1420739	hsa-miR-2467-5p	CLIP-seq
MIRT1420740	hsa-miR-2682	CLIP-seq
MIRT1420741	hsa-miR-26a	CLIP-seq
MIRT1420742	hsa-miR-26b	CLIP-seq
MIRT1420745	hsa-miR-300	CLIP-seq
MIRT1420749	hsa-miR-3117-5p	CLIP-seq
MIRT1420752	hsa-miR-3142	CLIP-seq
MIRT1420753	hsa-miR-3143	CLIP-seq
MIRT2126331	hsa-miR-3157-3p	CLIP-seq
MIRT1420755	hsa-miR-3159	CLIP-seq
MIRT1420757	hsa-miR-3161	CLIP-seq
MIRT1420760	hsa-miR-3188	CLIP-seq
MIRT1420763	hsa-miR-3606	CLIP-seq
MIRT1420764	hsa-miR-3607-3p	CLIP-seq
MIRT1420778	hsa-miR-381	CLIP-seq
MIRT1420784	hsa-miR-3975	CLIP-seq
MIRT1420787	hsa-miR-425	CLIP-seq
MIRT1420789	hsa-miR-4262	CLIP-seq
MIRT1420791	hsa-miR-4266	CLIP-seq
MIRT1420797	hsa-miR-4316	CLIP-seq
MIRT1420799	hsa-miR-4420	CLIP-seq
MIRT2126332	hsa-miR-4446-5p	CLIP-seq
MIRT1420805	hsa-miR-4465	CLIP-seq
MIRT1420806	hsa-miR-4477a	CLIP-seq
MIRT1420807	hsa-miR-449c	CLIP-seq
MIRT1420811	hsa-miR-4511	CLIP-seq
MIRT1420819	hsa-miR-4666-3p	CLIP-seq
MIRT1420821	hsa-miR-4684-3p	CLIP-seq
MIRT1420823	hsa-miR-4695-5p	CLIP-seq
MIRT1420827	hsa-miR-4709-3p	CLIP-seq
MIRT1420835	hsa-miR-4753-5p	CLIP-seq
MIRT2126333	hsa-miR-4755-5p	CLIP-seq
MIRT1420843	hsa-miR-4779	CLIP-seq
MIRT1420845	hsa-miR-4789-5p	CLIP-seq
MIRT1420848	hsa-miR-4803	CLIP-seq
MIRT1420850	hsa-miR-485-5p	CLIP-seq
MIRT1420852	hsa-miR-490-5p	CLIP-seq
MIRT1420865	hsa-miR-520d-5p	CLIP-seq
MIRT1420868	hsa-miR-524-5p	CLIP-seq
MIRT1420878	hsa-miR-548b-3p	CLIP-seq
MIRT1420896	hsa-miR-579	CLIP-seq
MIRT1420897	hsa-miR-582-3p	CLIP-seq
MIRT1420909	hsa-miR-642b	CLIP-seq
MIRT1420910	hsa-miR-651	CLIP-seq
MIRT2126334	hsa-miR-7	CLIP-seq
MIRT1420699	hsa-miR-1208	CLIP-seq
MIRT1420717	hsa-miR-140-5p	CLIP-seq
MIRT1420719	hsa-miR-148a	CLIP-seq
MIRT1420720	hsa-miR-148b	CLIP-seq
MIRT1420721	hsa-miR-152	CLIP-seq
MIRT1420740	hsa-miR-2682	CLIP-seq
MIRT1420758	hsa-miR-3163	CLIP-seq
MIRT1420770	hsa-miR-3660	CLIP-seq
MIRT1420782	hsa-miR-3973	CLIP-seq
MIRT1420792	hsa-miR-4273	CLIP-seq
MIRT1420794	hsa-miR-4282	CLIP-seq
MIRT1420799	hsa-miR-4420	CLIP-seq
MIRT1420807	hsa-miR-449c	CLIP-seq
MIRT1420813	hsa-miR-4526	CLIP-seq
MIRT1420865	hsa-miR-520d-5p	CLIP-seq
MIRT1420866	hsa-miR-520g	CLIP-seq
MIRT1420867	hsa-miR-520h	CLIP-seq
MIRT1420868	hsa-miR-524-5p	CLIP-seq
MIRT1420875	hsa-miR-548a-5p	CLIP-seq
MIRT1420876	hsa-miR-548ab	CLIP-seq
MIRT1420877	hsa-miR-548ak	CLIP-seq
MIRT1420879	hsa-miR-548b-5p	CLIP-seq
MIRT1420880	hsa-miR-548c-5p	CLIP-seq
MIRT1420881	hsa-miR-548d-5p	CLIP-seq
MIRT1420885	hsa-miR-548h	CLIP-seq
MIRT1420886	hsa-miR-548i	CLIP-seq
MIRT1420887	hsa-miR-548j	CLIP-seq
MIRT1420890	hsa-miR-548w	CLIP-seq
MIRT1420891	hsa-miR-548y	CLIP-seq
MIRT1420893	hsa-miR-559	CLIP-seq
MIRT1420897	hsa-miR-582-3p	CLIP-seq
MIRT1420899	hsa-miR-583	CLIP-seq
MIRT1420696	hsa-miR-10a	CLIP-seq
MIRT1420697	hsa-miR-10b	CLIP-seq
MIRT1420701	hsa-miR-1245b-5p	CLIP-seq
MIRT1420710	hsa-miR-129-3p	CLIP-seq
MIRT1420711	hsa-miR-1297	CLIP-seq
MIRT1420715	hsa-miR-136	CLIP-seq
MIRT1420932	hsa-miR-141	CLIP-seq
MIRT1420719	hsa-miR-148a	CLIP-seq
MIRT1420720	hsa-miR-148b	CLIP-seq
MIRT1420721	hsa-miR-152	CLIP-seq
MIRT2348345	hsa-miR-154	CLIP-seq
MIRT1420722	hsa-miR-181a	CLIP-seq
MIRT1420723	hsa-miR-181b	CLIP-seq
MIRT1420724	hsa-miR-181c	CLIP-seq
MIRT1420725	hsa-miR-181d	CLIP-seq
MIRT1420726	hsa-miR-182	CLIP-seq
MIRT1420936	hsa-miR-200a	CLIP-seq
MIRT1420732	hsa-miR-221	CLIP-seq
MIRT1420733	hsa-miR-222	CLIP-seq
MIRT1420938	hsa-miR-2355-5p	CLIP-seq
MIRT1420739	hsa-miR-2467-5p	CLIP-seq
MIRT1420740	hsa-miR-2682	CLIP-seq
MIRT1420741	hsa-miR-26a	CLIP-seq
MIRT1420742	hsa-miR-26b	CLIP-seq
MIRT1420744	hsa-miR-298	CLIP-seq
MIRT1420746	hsa-miR-3065-3p	CLIP-seq
MIRT1420748	hsa-miR-3115	CLIP-seq
MIRT1420749	hsa-miR-3117-5p	CLIP-seq
MIRT1420939	hsa-miR-3127-5p	CLIP-seq
MIRT1420752	hsa-miR-3142	CLIP-seq
MIRT1420753	hsa-miR-3143	CLIP-seq
MIRT1420943	hsa-miR-3187-3p	CLIP-seq
MIRT1420760	hsa-miR-3188	CLIP-seq
MIRT2348346	hsa-miR-320b	CLIP-seq
MIRT2348347	hsa-miR-320c	CLIP-seq
MIRT2348348	hsa-miR-320d	CLIP-seq
MIRT1420762	hsa-miR-338-3p	CLIP-seq
MIRT1420763	hsa-miR-3606	CLIP-seq
MIRT1420764	hsa-miR-3607-3p	CLIP-seq
MIRT2348349	hsa-miR-3616-5p	CLIP-seq
MIRT1420767	hsa-miR-3646	CLIP-seq
MIRT2348350	hsa-miR-3647-5p	CLIP-seq
MIRT1420770	hsa-miR-3660	CLIP-seq
MIRT1420945	hsa-miR-3667-3p	CLIP-seq
MIRT1420774	hsa-miR-3688-3p	CLIP-seq
MIRT1420775	hsa-miR-370	CLIP-seq
MIRT1420776	hsa-miR-374a	CLIP-seq
MIRT1420777	hsa-miR-374b	CLIP-seq
MIRT1420953	hsa-miR-3926	CLIP-seq
MIRT1420781	hsa-miR-3942-3p	CLIP-seq
MIRT1420782	hsa-miR-3973	CLIP-seq
MIRT1420784	hsa-miR-3975	CLIP-seq
MIRT1420789	hsa-miR-4262	CLIP-seq
MIRT1420790	hsa-miR-4264	CLIP-seq
MIRT1420792	hsa-miR-4273	CLIP-seq
MIRT1420794	hsa-miR-4282	CLIP-seq
MIRT1420957	hsa-miR-4286	CLIP-seq
MIRT1420797	hsa-miR-4316	CLIP-seq
MIRT1420959	hsa-miR-4318	CLIP-seq
MIRT2348351	hsa-miR-4429	CLIP-seq
MIRT1420960	hsa-miR-4435	CLIP-seq
MIRT1420803	hsa-miR-4443	CLIP-seq
MIRT1420805	hsa-miR-4465	CLIP-seq
MIRT1420806	hsa-miR-4477a	CLIP-seq
MIRT1420807	hsa-miR-449c	CLIP-seq
MIRT1420811	hsa-miR-4511	CLIP-seq
MIRT1420813	hsa-miR-4526	CLIP-seq
MIRT1420814	hsa-miR-4530	CLIP-seq
MIRT1420966	hsa-miR-4536	CLIP-seq
MIRT2348352	hsa-miR-4635	CLIP-seq
MIRT1420967	hsa-miR-4652-5p	CLIP-seq
MIRT1420820	hsa-miR-4670-3p	CLIP-seq
MIRT1420972	hsa-miR-4701-5p	CLIP-seq
MIRT1420827	hsa-miR-4709-3p	CLIP-seq
MIRT2348353	hsa-miR-4742-3p	CLIP-seq
MIRT1420835	hsa-miR-4753-5p	CLIP-seq
MIRT1420842	hsa-miR-4777-5p	CLIP-seq
MIRT1420845	hsa-miR-4789-5p	CLIP-seq
MIRT1420846	hsa-miR-4797-3p	CLIP-seq
MIRT1420848	hsa-miR-4803	CLIP-seq
MIRT1420850	hsa-miR-485-5p	CLIP-seq
MIRT1420852	hsa-miR-490-5p	CLIP-seq
MIRT1420861	hsa-miR-518d-5p	CLIP-seq
MIRT1420862	hsa-miR-519b-5p	CLIP-seq
MIRT1420863	hsa-miR-519c-5p	CLIP-seq
MIRT1420864	hsa-miR-520c-5p	CLIP-seq
MIRT1420866	hsa-miR-520g	CLIP-seq
MIRT1420867	hsa-miR-520h	CLIP-seq
MIRT1420869	hsa-miR-526a	CLIP-seq
MIRT1420875	hsa-miR-548a-5p	CLIP-seq
MIRT1420876	hsa-miR-548ab	CLIP-seq
MIRT1420877	hsa-miR-548ak	CLIP-seq
MIRT1420878	hsa-miR-548b-3p	CLIP-seq
MIRT1420879	hsa-miR-548b-5p	CLIP-seq
MIRT1420880	hsa-miR-548c-5p	CLIP-seq
MIRT1420881	hsa-miR-548d-5p	CLIP-seq
MIRT1420885	hsa-miR-548h	CLIP-seq
MIRT1420886	hsa-miR-548i	CLIP-seq
MIRT1420887	hsa-miR-548j	CLIP-seq
MIRT1420982	hsa-miR-548s	CLIP-seq
MIRT1420890	hsa-miR-548w	CLIP-seq
MIRT1420891	hsa-miR-548y	CLIP-seq
MIRT2348354	hsa-miR-552	CLIP-seq
MIRT1420893	hsa-miR-559	CLIP-seq
MIRT2348355	hsa-miR-573	CLIP-seq
MIRT1420896	hsa-miR-579	CLIP-seq
MIRT1420985	hsa-miR-588	CLIP-seq
MIRT1420909	hsa-miR-642b	CLIP-seq
MIRT1420914	hsa-miR-671-5p	CLIP-seq
MIRT2126334	hsa-miR-7	CLIP-seq
MIRT1420918	hsa-miR-765	CLIP-seq
MIRT1420921	hsa-miR-888	CLIP-seq
MIRT1420924	hsa-miR-922	CLIP-seq
MIRT1420717	hsa-miR-140-5p	CLIP-seq
MIRT1420719	hsa-miR-148a	CLIP-seq
MIRT1420720	hsa-miR-148b	CLIP-seq
MIRT1420721	hsa-miR-152	CLIP-seq
MIRT1420726	hsa-miR-182	CLIP-seq
MIRT1420735	hsa-miR-2276	CLIP-seq
MIRT1420770	hsa-miR-3660	CLIP-seq
MIRT1420771	hsa-miR-3663-5p	CLIP-seq
MIRT1420774	hsa-miR-3688-3p	CLIP-seq
MIRT1420794	hsa-miR-4282	CLIP-seq
MIRT1420963	hsa-miR-4496	CLIP-seq
MIRT1420813	hsa-miR-4526	CLIP-seq
MIRT1420840	hsa-miR-4772-3p	CLIP-seq
MIRT1420854	hsa-miR-498	CLIP-seq
MIRT1420865	hsa-miR-520d-5p	CLIP-seq
MIRT1420868	hsa-miR-524-5p	CLIP-seq
MIRT1420874	hsa-miR-548a-3p	CLIP-seq
MIRT1420882	hsa-miR-548e	CLIP-seq
MIRT1420883	hsa-miR-548f	CLIP-seq
MIRT1420897	hsa-miR-582-3p	CLIP-seq
MIRT1420899	hsa-miR-583	CLIP-seq
MIRT1420910	hsa-miR-651	CLIP-seq
MIRT1420922	hsa-miR-891b	CLIP-seq
MIRT1420701	hsa-miR-1245b-5p	CLIP-seq
MIRT1420711	hsa-miR-1297	CLIP-seq
MIRT1420722	hsa-miR-181a	CLIP-seq
MIRT1420723	hsa-miR-181b	CLIP-seq
MIRT1420724	hsa-miR-181c	CLIP-seq
MIRT1420725	hsa-miR-181d	CLIP-seq
MIRT1420739	hsa-miR-2467-5p	CLIP-seq
MIRT1420741	hsa-miR-26a	CLIP-seq
MIRT1420742	hsa-miR-26b	CLIP-seq
MIRT1420749	hsa-miR-3117-5p	CLIP-seq
MIRT1420752	hsa-miR-3142	CLIP-seq
MIRT1420753	hsa-miR-3143	CLIP-seq
MIRT1420760	hsa-miR-3188	CLIP-seq
MIRT1420764	hsa-miR-3607-3p	CLIP-seq
MIRT1420784	hsa-miR-3975	CLIP-seq
MIRT1420789	hsa-miR-4262	CLIP-seq
MIRT1420797	hsa-miR-4316	CLIP-seq
MIRT1420805	hsa-miR-4465	CLIP-seq
MIRT1420806	hsa-miR-4477a	CLIP-seq
MIRT1420835	hsa-miR-4753-5p	CLIP-seq
MIRT1420848	hsa-miR-4803	CLIP-seq
MIRT1420850	hsa-miR-485-5p	CLIP-seq
MIRT1420909	hsa-miR-642b	CLIP-seq
MIRT1420827	hsa-miR-4709-3p	CLIP-seq
MIRT1420711	hsa-miR-1297	CLIP-seq
MIRT1420722	hsa-miR-181a	CLIP-seq
MIRT1420723	hsa-miR-181b	CLIP-seq
MIRT1420724	hsa-miR-181c	CLIP-seq
MIRT1420725	hsa-miR-181d	CLIP-seq
MIRT2126330	hsa-miR-218	CLIP-seq
MIRT1420739	hsa-miR-2467-5p	CLIP-seq
MIRT1420741	hsa-miR-26a	CLIP-seq
MIRT1420742	hsa-miR-26b	CLIP-seq
MIRT1420760	hsa-miR-3188	CLIP-seq
MIRT1420764	hsa-miR-3607-3p	CLIP-seq
MIRT1420784	hsa-miR-3975	CLIP-seq
MIRT1420789	hsa-miR-4262	CLIP-seq
MIRT1420797	hsa-miR-4316	CLIP-seq
MIRT1420805	hsa-miR-4465	CLIP-seq
MIRT1420850	hsa-miR-485-5p	CLIP-seq
MIRT1420897	hsa-miR-582-3p	CLIP-seq
MIRT1420909	hsa-miR-642b	CLIP-seq
MIRT1420696	hsa-miR-10a	CLIP-seq
MIRT1420697	hsa-miR-10b	CLIP-seq
MIRT1420698	hsa-miR-1179	CLIP-seq
MIRT2641079	hsa-miR-1236	CLIP-seq
MIRT1420701	hsa-miR-1245b-5p	CLIP-seq
MIRT1420702	hsa-miR-1253	CLIP-seq
MIRT1420703	hsa-miR-1261	CLIP-seq
MIRT1420709	hsa-miR-1286	CLIP-seq
MIRT1420710	hsa-miR-129-3p	CLIP-seq
MIRT1420931	hsa-miR-1298	CLIP-seq
MIRT1420715	hsa-miR-136	CLIP-seq
MIRT1420716	hsa-miR-140-3p	CLIP-seq
MIRT1420726	hsa-miR-182	CLIP-seq
MIRT1420937	hsa-miR-2116	CLIP-seq
MIRT1420729	hsa-miR-214	CLIP-seq
MIRT1420731	hsa-miR-217	CLIP-seq
MIRT2126330	hsa-miR-218	CLIP-seq
MIRT1420743	hsa-miR-28-5p	CLIP-seq
MIRT1420744	hsa-miR-298	CLIP-seq
MIRT1420746	hsa-miR-3065-3p	CLIP-seq
MIRT1420747	hsa-miR-31	CLIP-seq
MIRT1420749	hsa-miR-3117-5p	CLIP-seq
MIRT1420750	hsa-miR-3126-3p	CLIP-seq
MIRT2641080	hsa-miR-3133	CLIP-seq
MIRT1420751	hsa-miR-3139	CLIP-seq
MIRT1420752	hsa-miR-3142	CLIP-seq
MIRT1420753	hsa-miR-3143	CLIP-seq
MIRT1420941	hsa-miR-3145-3p	CLIP-seq
MIRT2126331	hsa-miR-3157-3p	CLIP-seq
MIRT1420755	hsa-miR-3159	CLIP-seq
MIRT1420758	hsa-miR-3163	CLIP-seq
MIRT1420759	hsa-miR-3168	CLIP-seq
MIRT2641081	hsa-miR-3182	CLIP-seq
MIRT1420944	hsa-miR-3200-3p	CLIP-seq
MIRT2641082	hsa-miR-323-3p	CLIP-seq
MIRT1420762	hsa-miR-338-3p	CLIP-seq
MIRT1420763	hsa-miR-3606	CLIP-seq
MIRT1420765	hsa-miR-3617	CLIP-seq
MIRT1420766	hsa-miR-3619-5p	CLIP-seq
MIRT2641083	hsa-miR-362-5p	CLIP-seq
MIRT1420768	hsa-miR-3647-3p	CLIP-seq
MIRT1420771	hsa-miR-3663-5p	CLIP-seq
MIRT1420774	hsa-miR-3688-3p	CLIP-seq
MIRT1420775	hsa-miR-370	CLIP-seq
MIRT1420776	hsa-miR-374a	CLIP-seq
MIRT1420777	hsa-miR-374b	CLIP-seq
MIRT1420779	hsa-miR-3919	CLIP-seq
MIRT1420781	hsa-miR-3942-3p	CLIP-seq
MIRT1420783	hsa-miR-3974	CLIP-seq
MIRT1420786	hsa-miR-421	CLIP-seq
MIRT1420787	hsa-miR-425	CLIP-seq
MIRT2641084	hsa-miR-4259	CLIP-seq
MIRT1420791	hsa-miR-4266	CLIP-seq
MIRT1420792	hsa-miR-4273	CLIP-seq
MIRT1420794	hsa-miR-4282	CLIP-seq
MIRT1420795	hsa-miR-4291	CLIP-seq
MIRT1420796	hsa-miR-4310	CLIP-seq
MIRT1420959	hsa-miR-4318	CLIP-seq
MIRT1420799	hsa-miR-4420	CLIP-seq
MIRT1420800	hsa-miR-4425	CLIP-seq
MIRT1420801	hsa-miR-4433	CLIP-seq
MIRT2126332	hsa-miR-4446-5p	CLIP-seq
MIRT1420961	hsa-miR-4461	CLIP-seq
MIRT1420806	hsa-miR-4477a	CLIP-seq
MIRT1420963	hsa-miR-4496	CLIP-seq
MIRT2641085	hsa-miR-450b-3p	CLIP-seq
MIRT1420810	hsa-miR-450b-5p	CLIP-seq
MIRT1420811	hsa-miR-4511	CLIP-seq
MIRT1420814	hsa-miR-4530	CLIP-seq
MIRT1420966	hsa-miR-4536	CLIP-seq
MIRT1420817	hsa-miR-4637	CLIP-seq
MIRT1420818	hsa-miR-4662a-3p	CLIP-seq
MIRT2641086	hsa-miR-4666-5p	CLIP-seq
MIRT1420970	hsa-miR-4677-5p	CLIP-seq
MIRT2641087	hsa-miR-4694-3p	CLIP-seq
MIRT1420823	hsa-miR-4695-5p	CLIP-seq
MIRT1420826	hsa-miR-4699-5p	CLIP-seq
MIRT1420827	hsa-miR-4709-3p	CLIP-seq
MIRT1420828	hsa-miR-4709-5p	CLIP-seq
MIRT1420832	hsa-miR-4722-5p	CLIP-seq
MIRT1420835	hsa-miR-4753-5p	CLIP-seq
MIRT2126333	hsa-miR-4755-5p	CLIP-seq
MIRT1420836	hsa-miR-4756-3p	CLIP-seq
MIRT2641088	hsa-miR-4766-5p	CLIP-seq
MIRT2641089	hsa-miR-4777-3p	CLIP-seq
MIRT1420842	hsa-miR-4777-5p	CLIP-seq
MIRT1420843	hsa-miR-4779	CLIP-seq
MIRT1420844	hsa-miR-4786-5p	CLIP-seq
MIRT1420845	hsa-miR-4789-5p	CLIP-seq
MIRT1420847	hsa-miR-4798-3p	CLIP-seq
MIRT1420848	hsa-miR-4803	CLIP-seq
MIRT1420852	hsa-miR-490-5p	CLIP-seq
MIRT2641090	hsa-miR-495	CLIP-seq
MIRT1420854	hsa-miR-498	CLIP-seq
MIRT2641091	hsa-miR-500b	CLIP-seq
MIRT2641092	hsa-miR-501-5p	CLIP-seq
MIRT1420855	hsa-miR-507	CLIP-seq
MIRT1420858	hsa-miR-513c	CLIP-seq
MIRT1420859	hsa-miR-514b-5p	CLIP-seq
MIRT1420861	hsa-miR-518d-5p	CLIP-seq
MIRT1420862	hsa-miR-519b-5p	CLIP-seq
MIRT1420863	hsa-miR-519c-5p	CLIP-seq
MIRT1420864	hsa-miR-520c-5p	CLIP-seq
MIRT2641093	hsa-miR-522	CLIP-seq
MIRT1420869	hsa-miR-526a	CLIP-seq
MIRT1420874	hsa-miR-548a-3p	CLIP-seq
MIRT1420976	hsa-miR-548aa	CLIP-seq
MIRT1420977	hsa-miR-548ac	CLIP-seq
MIRT1420978	hsa-miR-548ae	CLIP-seq
MIRT1420979	hsa-miR-548aj	CLIP-seq
MIRT1420980	hsa-miR-548am	CLIP-seq
MIRT1420878	hsa-miR-548b-3p	CLIP-seq
MIRT1420981	hsa-miR-548d-3p	CLIP-seq
MIRT1420882	hsa-miR-548e	CLIP-seq
MIRT1420883	hsa-miR-548f	CLIP-seq
MIRT1420884	hsa-miR-548g	CLIP-seq
MIRT1420888	hsa-miR-548m	CLIP-seq
MIRT1420983	hsa-miR-548x	CLIP-seq
MIRT1420984	hsa-miR-548z	CLIP-seq
MIRT1420892	hsa-miR-557	CLIP-seq
MIRT1420895	hsa-miR-570	CLIP-seq
MIRT2641094	hsa-miR-571	CLIP-seq
MIRT1420896	hsa-miR-579	CLIP-seq
MIRT1420897	hsa-miR-582-3p	CLIP-seq
MIRT1420903	hsa-miR-610	CLIP-seq
MIRT1420907	hsa-miR-634	CLIP-seq
MIRT1420908	hsa-miR-641	CLIP-seq
MIRT1420910	hsa-miR-651	CLIP-seq
MIRT1420911	hsa-miR-664	CLIP-seq
MIRT1420912	hsa-miR-665	CLIP-seq
MIRT1420913	hsa-miR-668	CLIP-seq
MIRT2126334	hsa-miR-7	CLIP-seq
MIRT1420915	hsa-miR-708	CLIP-seq
MIRT1420917	hsa-miR-761	CLIP-seq
MIRT2641095	hsa-miR-769-3p	CLIP-seq
MIRT1420988	hsa-miR-873	CLIP-seq
MIRT1420924	hsa-miR-922	CLIP-seq
MIRT1420925	hsa-miR-938	CLIP-seq
MIRT1420701	hsa-miR-1245b-5p	CLIP-seq
MIRT1420702	hsa-miR-1253	CLIP-seq
MIRT1420703	hsa-miR-1261	CLIP-seq
MIRT1420709	hsa-miR-1286	CLIP-seq
MIRT1420710	hsa-miR-129-3p	CLIP-seq
MIRT1420931	hsa-miR-1298	CLIP-seq
MIRT1420715	hsa-miR-136	CLIP-seq
MIRT1420716	hsa-miR-140-3p	CLIP-seq
MIRT1420726	hsa-miR-182	CLIP-seq
MIRT1420937	hsa-miR-2116	CLIP-seq
MIRT1420729	hsa-miR-214	CLIP-seq
MIRT2126330	hsa-miR-218	CLIP-seq
MIRT1420736	hsa-miR-23a	CLIP-seq
MIRT1420737	hsa-miR-23b	CLIP-seq
MIRT1420738	hsa-miR-23c	CLIP-seq
MIRT1420744	hsa-miR-298	CLIP-seq
MIRT1420746	hsa-miR-3065-3p	CLIP-seq
MIRT1420749	hsa-miR-3117-5p	CLIP-seq
MIRT1420752	hsa-miR-3142	CLIP-seq
MIRT1420753	hsa-miR-3143	CLIP-seq
MIRT1420941	hsa-miR-3145-3p	CLIP-seq
MIRT2126331	hsa-miR-3157-3p	CLIP-seq
MIRT1420755	hsa-miR-3159	CLIP-seq
MIRT1420758	hsa-miR-3163	CLIP-seq
MIRT1420759	hsa-miR-3168	CLIP-seq
MIRT1420944	hsa-miR-3200-3p	CLIP-seq
MIRT2641082	hsa-miR-323-3p	CLIP-seq
MIRT1420762	hsa-miR-338-3p	CLIP-seq
MIRT1420763	hsa-miR-3606	CLIP-seq
MIRT1420765	hsa-miR-3617	CLIP-seq
MIRT1420766	hsa-miR-3619-5p	CLIP-seq
MIRT2641083	hsa-miR-362-5p	CLIP-seq
MIRT1420768	hsa-miR-3647-3p	CLIP-seq
MIRT1420774	hsa-miR-3688-3p	CLIP-seq
MIRT1420776	hsa-miR-374a	CLIP-seq
MIRT1420777	hsa-miR-374b	CLIP-seq
MIRT1420779	hsa-miR-3919	CLIP-seq
MIRT1420781	hsa-miR-3942-3p	CLIP-seq
MIRT1420783	hsa-miR-3974	CLIP-seq
MIRT1420786	hsa-miR-421	CLIP-seq
MIRT1420787	hsa-miR-425	CLIP-seq
MIRT2641084	hsa-miR-4259	CLIP-seq
MIRT1420791	hsa-miR-4266	CLIP-seq
MIRT1420792	hsa-miR-4273	CLIP-seq
MIRT1420794	hsa-miR-4282	CLIP-seq
MIRT1420795	hsa-miR-4291	CLIP-seq
MIRT1420959	hsa-miR-4318	CLIP-seq
MIRT1420800	hsa-miR-4425	CLIP-seq
MIRT1420801	hsa-miR-4433	CLIP-seq
MIRT2126332	hsa-miR-4446-5p	CLIP-seq
MIRT1420961	hsa-miR-4461	CLIP-seq
MIRT1420806	hsa-miR-4477a	CLIP-seq
MIRT2641085	hsa-miR-450b-3p	CLIP-seq
MIRT1420810	hsa-miR-450b-5p	CLIP-seq
MIRT1420811	hsa-miR-4511	CLIP-seq
MIRT1420814	hsa-miR-4530	CLIP-seq
MIRT1420966	hsa-miR-4536	CLIP-seq
MIRT1420817	hsa-miR-4637	CLIP-seq
MIRT1420818	hsa-miR-4662a-3p	CLIP-seq
MIRT2641086	hsa-miR-4666-5p	CLIP-seq
MIRT1420970	hsa-miR-4677-5p	CLIP-seq
MIRT1420823	hsa-miR-4695-5p	CLIP-seq
MIRT1420827	hsa-miR-4709-3p	CLIP-seq
MIRT1420828	hsa-miR-4709-5p	CLIP-seq
MIRT1420832	hsa-miR-4722-5p	CLIP-seq
MIRT1420835	hsa-miR-4753-5p	CLIP-seq
MIRT2126333	hsa-miR-4755-5p	CLIP-seq
MIRT1420836	hsa-miR-4756-3p	CLIP-seq
MIRT2641089	hsa-miR-4777-3p	CLIP-seq
MIRT1420842	hsa-miR-4777-5p	CLIP-seq
MIRT1420843	hsa-miR-4779	CLIP-seq
MIRT1420844	hsa-miR-4786-5p	CLIP-seq
MIRT1420845	hsa-miR-4789-5p	CLIP-seq
MIRT1420847	hsa-miR-4798-3p	CLIP-seq
MIRT2692957	hsa-miR-4802-5p	CLIP-seq
MIRT1420848	hsa-miR-4803	CLIP-seq
MIRT1420854	hsa-miR-498	CLIP-seq
MIRT2641091	hsa-miR-500b	CLIP-seq
MIRT2641092	hsa-miR-501-5p	CLIP-seq
MIRT1420855	hsa-miR-507	CLIP-seq
MIRT1420858	hsa-miR-513c	CLIP-seq
MIRT1420859	hsa-miR-514b-5p	CLIP-seq
MIRT1420861	hsa-miR-518d-5p	CLIP-seq
MIRT1420862	hsa-miR-519b-5p	CLIP-seq
MIRT1420863	hsa-miR-519c-5p	CLIP-seq
MIRT1420864	hsa-miR-520c-5p	CLIP-seq
MIRT1420869	hsa-miR-526a	CLIP-seq
MIRT1420874	hsa-miR-548a-3p	CLIP-seq
MIRT1420977	hsa-miR-548ac	CLIP-seq
MIRT1420978	hsa-miR-548ae	CLIP-seq
MIRT1420979	hsa-miR-548aj	CLIP-seq
MIRT1420980	hsa-miR-548am	CLIP-seq
MIRT1420878	hsa-miR-548b-3p	CLIP-seq
MIRT1420981	hsa-miR-548d-3p	CLIP-seq
MIRT1420882	hsa-miR-548e	CLIP-seq
MIRT1420883	hsa-miR-548f	CLIP-seq
MIRT1420884	hsa-miR-548g	CLIP-seq
MIRT1420888	hsa-miR-548m	CLIP-seq
MIRT1420983	hsa-miR-548x	CLIP-seq
MIRT1420984	hsa-miR-548z	CLIP-seq
MIRT1420892	hsa-miR-557	CLIP-seq
MIRT2641094	hsa-miR-571	CLIP-seq
MIRT1420896	hsa-miR-579	CLIP-seq
MIRT1420897	hsa-miR-582-3p	CLIP-seq
MIRT1420903	hsa-miR-610	CLIP-seq
MIRT1420908	hsa-miR-641	CLIP-seq
MIRT1420910	hsa-miR-651	CLIP-seq
MIRT1420911	hsa-miR-664	CLIP-seq
MIRT1420913	hsa-miR-668	CLIP-seq
MIRT2126334	hsa-miR-7	CLIP-seq
MIRT1420917	hsa-miR-761	CLIP-seq
MIRT2641095	hsa-miR-769-3p	CLIP-seq
MIRT1420988	hsa-miR-873	CLIP-seq
MIRT1420924	hsa-miR-922	CLIP-seq
MIRT1420925	hsa-miR-938	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
HIF1A	Unknown	10446187;10446188
MYC	Activation	16466700
VHL	Repression	15985433
YY1	Unknown	19437620

Show/Hide all (98)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001558	Process	Regulation of cell growth	IMP	7556058
GO:0001618	Function	Virus receptor activity	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003725	Function	Double-stranded RNA binding	IDA	21266579
GO:0004998	Function	Transferrin receptor activity	IDA	9465039, 18353247, 26642240
GO:0004998	Function	Transferrin receptor activity	IEA
GO:0004998	Function	Transferrin receptor activity	NAS	1871153
GO:0004998	Function	Transferrin receptor activity	TAS	10192390
GO:0005515	Function	Protein binding	IPI	9465039, 9546397, 9990067, 10638746, 14691533, 15965644, 16271884, 16325581, 16354665, 18353247, 20133674, 20404192, 20618438, 21788477, 23016877, 23384347, 25416956, 26642240, 29302006, 29388418, 29950717, 32296183, 38625739
GO:0005576	Component	Extracellular region	IDA	1871153
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	HDA	22664934
GO:0005615	Component	Extracellular space	IEA
GO:0005768	Component	Endosome	IDA	14612438
GO:0005768	Component	Endosome	IEA
GO:0005768	Component	Endosome	TAS	8394993
GO:0005769	Component	Early endosome	IEA
GO:0005886	Component	Plasma membrane	IDA	26642240
GO:0005886	Component	Plasma membrane	IDA	23137377
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IGI	18353247
GO:0005886	Component	Plasma membrane	TAS	6090955
GO:0005905	Component	Clathrin-coated pit	IDA	12857860
GO:0005905	Component	Clathrin-coated pit	IEA
GO:0006826	Process	Iron ion transport	IBA
GO:0006826	Process	Iron ion transport	IDA	7556058
GO:0006879	Process	Intracellular iron ion homeostasis	IBA
GO:0006879	Process	Intracellular iron ion homeostasis	IEA
GO:0006879	Process	Intracellular iron ion homeostasis	NAS	1871153
GO:0006879	Process	Intracellular iron ion homeostasis	TAS	10192390
GO:0006897	Process	Endocytosis	IEA
GO:0006898	Process	Receptor-mediated endocytosis	IDA	9465039
GO:0006898	Process	Receptor-mediated endocytosis	IEA
GO:0006953	Process	Acute-phase response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IDA	9465039
GO:0007584	Process	Response to nutrient	IEA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009897	Component	External side of plasma membrane	IGI	18353247
GO:0009986	Component	Cell surface	IDA	7556058
GO:0009986	Component	Cell surface	IEA
GO:0009986	Component	Cell surface	ISS	18619525
GO:0010008	Component	Endosome membrane	IDA	16380373
GO:0010008	Component	Endosome membrane	TAS
GO:0010039	Process	Response to iron ion	IEA
GO:0010042	Process	Response to manganese ion	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	23016877
GO:0010637	Process	Negative regulation of mitochondrial fusion	IMP	26214738
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	1871153
GO:0016323	Component	Basolateral plasma membrane	IDA	9990067
GO:0019901	Function	Protein kinase binding	IPI	23016877
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0030544	Function	Hsp70 protein binding	IEA
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0030890	Process	Positive regulation of B cell proliferation	IDA	26642240
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IMP	23016877
GO:0031410	Component	Cytoplasmic vesicle	IDA	15229288
GO:0031623	Process	Receptor internalization	IDA	26642240
GO:0032526	Process	Response to retinoic acid	IEA
GO:0033572	Process	Transferrin transport	IDA	9465039, 18353247, 26642240
GO:0033572	Process	Transferrin transport	IEA
GO:0035556	Process	Intracellular signal transduction	IMP	26214738
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	26642240
GO:0042127	Process	Regulation of cell population proliferation	IMP	7556058
GO:0042470	Component	Melanosome	IEA
GO:0042802	Function	Identical protein binding	IPI	20208545, 23384347, 29302006
GO:0042803	Function	Protein homodimerization activity	IPI	9546397
GO:0043066	Process	Negative regulation of apoptotic process	IMP	23016877
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	23016877
GO:0044877	Function	Protein-containing complex binding	IPI	23016877
GO:0045830	Process	Positive regulation of isotype switching	IDA	26642240
GO:0046688	Process	Response to copper ion	IEA
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	16380373, 20202662
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051087	Function	Protein-folding chaperone binding	IEA
GO:0055037	Component	Recycling endosome	IDA	22456507, 24561039
GO:0055037	Component	Recycling endosome	IEA
GO:0055038	Component	Recycling endosome membrane	IEA
GO:0060586	Process	Multicellular organismal-level iron ion homeostasis	IDA	26642240
GO:0060586	Process	Multicellular organismal-level iron ion homeostasis	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070062	Component	Extracellular exosome	IEA
GO:0071466	Process	Cellular response to xenobiotic stimulus	IDA	16254249
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0098794	Component	Postsynapse	IEA
GO:0098944	Component	Postsynaptic recycling endosome membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099072	Process	Regulation of postsynaptic membrane neurotransmitter receptor levels	IEA
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653
GO:1900182	Process	Positive regulation of protein localization to nucleus	IMP	23016877
GO:1903561	Component	Extracellular vesicle	HDA	24769233
GO:1990712	Component	HFE-transferrin receptor complex	IDA	9465039, 9546397, 9990067
GO:1990712	Component	HFE-transferrin receptor complex	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA

MIM	HGNC	e!Ensembl
190010	11763	ENSG00000072274

P02786

Protein name

Transferrin receptor protein 1 (TR) (TfR) (TfR1) (Trfr) (T9) (p90) (CD antigen CD71) [Cleaved into: Transferrin receptor protein 1, serum form (sTfR)]

Protein function

Cellular uptake of iron occurs via receptor-mediated endocytosis of ligand-occupied transferrin receptor into specialized endosomes (PubMed:26214738). Endosomal acidification leads to iron release. The apotransferrin-receptor complex is then rec

PDB

1CX8 , 1DE4 , 1SUV , 2NSU , 3KAS , 3S9L , 3S9M , 3S9N , 6D03 , 6D04 , 6D05 , 6GSR , 6H5I , 6OKD , 6W3H , 6WRV , 6WRW , 6WRX , 6Y76 , 7ZQS , 8P0Z

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02225	PA	228 → 345	PA domain	Family
PF04389	Peptidase_M28	388 → 594	Peptidase family M28	Family
PF04253	TFR_dimer	637 → 750	Transferrin receptor-like dimerisation domain	Domain

Sequence

MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENADNNTKANVTKPK
RCSGSICYGTIAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAAR
RLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSK
VWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTK
KDFEDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVLIYMDQTKFPIVNAELSFFGH
AHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAEKLFGNMEGDCPSDWKTD
STCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSG
VGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFT
YINLDKAVLGTSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLDNA
AFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELIERIPELNKVARAAAEVAGQFVIK
LTHDVELNLDYERYNSQLLSFVRDLNQYRADIKEMGLSLQWLYSARGDFFRATSRLTTDF
GNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHVFWGSGSHTLPALLENLKLRK
QNNGAFNETLFRNQLALATWTIQGAANALSGDVWDIDNEF

Sequence length

760

Interactions

View interactions

	KEGG		Reactome
	Virion - Lassa virus and SFTS virus HIF-1 signaling pathway Endocytosis Phagosome Ferroptosis TGF-beta signaling pathway Hematopoietic cell lineage		Golgi Associated Vesicle Biogenesis Cargo recognition for clathrin-mediated endocytosis Clathrin-mediated endocytosis Transferrin endocytosis and recycling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
TFRC-related combined immunodeficiency	Pathogenic	rs1341988492	RCV000714864	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (35)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA, IRON-DEFICIENCY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BETA THALASSEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BETA-THALASSEMIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Combined immunodeficiency	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMBINED IMMUNODEFICIENCY DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMBINED IMMUNODEFICIENCY DUE TO TFRC DEFICIENCY	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary breast ovarian cancer syndrome	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 46	—	CTD, HPO CTD, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRON METABOLISM DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, LYMPHOCYTIC, CHRONIC, B-CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OTHER SPECIFIED IRON DEFICIENCY ANEMIAS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE COMBINED IMMUNODEFICIENCY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TFRC-related disorder	Likely benign; Uncertain significance; Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (364)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	2268267, 23609441, 23962073, 7742556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	23962073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	28656755, 29875008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	23962073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	23962073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	23962073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	28836100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	23962073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27236820, 29286585, 31843580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	29295890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	15668490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	32207273, 33626208	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	24894955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	29875008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	28029547, 28513139, 7643997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	28189691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	25915522		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha-Thalassemia	alpha Thalassemia	BEFREE	9827906		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha^+^ Thalassemia	alpha Thalassemia	BEFREE	9827906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	29291011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	10468869, 11313310, 26642240, 28151426, 28216263, 28615252, 28700535, 29291011, 29668567, 29924320, 30034931, 30050123, 30342530, 30538074, 30968565, 31601941 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	11954010, 37623041	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	LHGDN	18586377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	8701944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	37658365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Iron Deficiency	Iron deficiency anemia	Pubtator	11954010, 26339443, 29110513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	35099119	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Diamond-Blackfan	Anemia	BEFREE	18815190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic	Anemia	LHGDN	12707725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	2372483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	8701944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	23243209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11954010, 2964958, 38046263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	3002686	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASCAT_DG	30929738		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	35602900	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	Pubtator	12767055	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	19386095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	16959548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	18445768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	23243209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	31936202	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic behavior	Autism	BEFREE	29054881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	34669781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	28762519		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30604643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bare Lymphocyte Syndrome	Bare Lymphocyte Syndrome	CTD_human_DG	26642240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	15538718		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	16755567, 2328791, 30118703, 7843631		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
beta Thalassemia	beta Thalassemia	CTD_human_DG	16755567		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
beta Thalassemia	Beta thalassemia	Pubtator	18166793, 27228385	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
beta Thalassemia	beta Thalassemia	LHGDN	18665828		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Beta thalassemia intermedia	beta Thalassemia	BEFREE	25425686		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	16755567, 2328791, 30118703, 7843631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	16904380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30782157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	31273671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	10626807, 15173073, 22117970, 27374198, 28122295, 28837569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	19386095, 28837569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10573112, 11299801, 11497259, 12489850, 12676065, 15894659, 16721748, 19238537, 20392994, 21859709, 26944411, 27028868, 28223798, 28972460, 30920802 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	16904380, 19238537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21875943, 27223606, 39770056, 6296151	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	26944411, 34518441	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	3033649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32476555	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36703617	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	1326756, 22941037, 2366002, 24353179, 30728365, 31118631	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32476555	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33351833	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	32661241	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30782157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16092918, 28572169, 31326524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	34258619, 39256468	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33850477, 37940859	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22159558, 24457517, 33671013, 34940125, 3498714, 37584713	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	34669781	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	23751596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Intimal Medial Thickness 1	Carotid intima-media thickness	Pubtator	18445768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	18445768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	LHGDN	18166587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	27101536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28919749, 30663409		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30651591		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	30651591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	25085015, 29875008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	23940083, 28029547, 28513139, 7643997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28671021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	29247214, 37056930	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30991414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	16054692, 16326028, 18621559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	CTD_human_DG	16904380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	19258483, 20861460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21915296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	1889695	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36703617	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11096344, 15941956, 24687888, 31372038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	16111806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	16111806		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16641131, 24078156, 24687888, 36703617	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Combined immunodeficiency	Severe combined immunodeficiency disease	GENOMICS_ENGLAND_DG	26642240		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Combined immunodeficiency	Severe combined immunodeficiency disease	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Combined immunodeficiency due to TFRC deficiency	Immunodeficiency	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Abnormalities	Congenital abnormalities	Pubtator	33084842	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	3469019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	29247214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital dyserythropoietic anemia, type II	Congenital dyserythropoietic anemia	BEFREE	10468869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	21777743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29291011, 8050820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cooley`s anemia	Cooley`s Anemia	CTD_human_DG	16755567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	32321351	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	3040543	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	11809765, 32616918	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	22450556, 28919749, 30581781, 31296086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	22450556, 23243209, 28919749, 30581781, 31296086		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	32483133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32041280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29899542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20497464, 22450556, 28075490, 29305826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	10997688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	31838906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	30584304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Mixed-Cell Lymphoma	Diffuse Lymphoma	CTD_human_DG	16904380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism Pituitary	Pituitary dwarfism	Pubtator	9466567	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythropoietic Protoporphyria	Erythropoietic Protoporphyria	BEFREE	30712775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	15761962, 20686364	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	9827906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	25647178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	25000850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Friedreich Ataxia	BEFREE	10805340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	30391537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	BEFREE	30342530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	21171987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	21171987	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	29317695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	20085643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	20085643, 36415692	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	18230189, 25356585, 28837569, 31284665, 32897363, 40649908	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27436023, 29592883, 29715532, 31284665, 31730913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25891893, 27436023, 29592883, 29715532, 31284665, 31730913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	CTD_human_DG	16904380		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	22117970, 28728419, 29088799, 29732051, 8264887		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	26956814, 27898674, 40649908	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	BEFREE	28750925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	28750925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	16928613, 28750925, 32791747, 33122053	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	33987447	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	28262749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	21777743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	34868339	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	2301380, 25503078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	21870996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	10318901, 11940510, 12429850, 3002171, 9371823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	BEFREE	10383894, 11027676, 11096344, 11313310, 14557859, 15642666, 15698609, 15894659, 18157833, 21384276, 21979376, 22575277, 8045562, 8178799, 9715407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	LHGDN	11783942, 15880641		★★★★★ ★☆☆☆☆ Found in Text Mining only
HEMOCHROMATOSIS, TYPE 1	Hemochromatosis	BEFREE	10383894, 11027676, 11313265, 11313310, 11929045, 14557859, 15642666, 15698609, 15894659, 15941956, 17956864, 18157833, 21384276, 21979376, 22575277, 25085015, 8045562, 8178799 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobin F Disease	Hemoglobinopathy	CTD_human_DG	16755567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	23754414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	27956696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	10087990, 10318901, 10369785, 10681454, 10878571, 10940080, 11027676, 11096344, 11146662, 11196670, 11260522, 11783942, 12429850, 19000667, 1915805 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
High Grade Lymphoma (neoplasm)	High Grade Lymphoma	CTD_human_DG	16904380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	1996560, 8605360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	6370286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Howell-Jolly Bodies	Howell-Jolly Bodies	BEFREE	17258066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	20547568, 30002810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	29899851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	25193495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28836100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	25385842, 30207798, 30292428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	33084842	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29500668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	Pubtator	27292585	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	10446187, 18508787, 19828835, 32682355	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	16310037, 18419598, 19139726, 22761861, 25193495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30226555	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31051082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	31051082	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	15987753, 28750925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	29691917, 38270687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IMMUNODEFICIENCY 46	Immunodeficiency	UNIPROT_DG	26642240		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 46	Immunodeficiency	ORPHANET_DG	26642240		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 46	Immunodeficiency	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 46	Immunodeficiency	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	29943722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30272151, 30538074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	21285140	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron deficiency anemia	Iron deficiency anemia	BEFREE	12870058, 21973163, 2328791, 26303393, 28468320, 29121448, 29271190, 30538074, 30575959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron deficiency anemia	Iron deficiency anemia	LHGDN	16271988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron deficiency anemia	Iron deficiency anemia	CTD_human_DG	16733738, 17162259, 17163184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Metabolism Disorders	Iron Metabolism Disorders	CTD_human_DG	17163184, 17254562		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Iron Overload	Iron Overload	BEFREE	10468869, 10592329, 10681454, 11260010, 12851122, 17488680, 1959858, 2179037, 23751596, 25385842, 28151426, 28671201, 28707012, 28803808, 29395073 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	27667164, 29395073, 33236955, 33529321, 34022567, 35602900, 35644542	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron-Refractory Iron Deficiency Anemia	Anemia	BEFREE	18685102, 25425686, 30093529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	30272151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29271190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	23283470	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	12010811, 22763969, 3017348, 3465751, 6313760, 9428630, 9616166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	2064352, 23962073, 30604643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11722405, 12921947, 15015967, 23962073, 27468886, 30984961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	24890018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11096344, 12029631, 12118381, 14512884, 18347429, 19387685, 26657500, 30076742, 30395963, 30728365, 30811632, 31293575, 8380064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	11096344, 30811632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	24894955	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	14512884, 18347429, 31102765, 8380064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	32476555	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Low Grade Lymphoma (neoplasm)	Low Grade Lymphoma	CTD_human_DG	16904380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	31051082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	31051082	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	10607488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	16092918		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	16904380		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	26604751, 29286585, 29649293, 9192985	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17868260	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	7531628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	38409788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	32851577	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	16326028, 30604643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	1704266, 22763969, 2366002, 2479430, 2933960, 35875870, 8761380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	1704266	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Diffuse	Lymphoma	CTD_human_DG	16904380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Intermediate-Grade	Intermediate Grade Lymphoma	CTD_human_DG	16904380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Mixed-Cell	Lymphoma	CTD_human_DG	16904380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	CTD_human_DG	16904380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	8209868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	CTD_human_DG	16904380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	8209868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Small Noncleaved-Cell	Lymphoma	CTD_human_DG	16904380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Undifferentiated	Lymphoma	CTD_human_DG	16904380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	25915522	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	29742327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	CTD_human_DG	16904380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	28262749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	15173073, 28122295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10573112, 11299801, 11497259, 12489850, 12676065, 15894659, 16721748, 19238537, 20392994, 21859709, 26944411, 27028868, 28223798, 28972460, 30920802 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	16904380, 19238537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16092918, 28572169, 29286585, 31326524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	16904380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	24890018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	24909164, 28262749, 31185171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15538718, 15833840, 27509031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12118381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	16904380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30782157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11722405, 12118381, 16326028, 16508012, 16510596, 17927572, 19135902, 19258483, 19342998, 21849092, 22355336, 22761861, 24436117, 2747289, 27523281 View all (16 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30651591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	31565748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	16904380, 19238537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	16904380, 19238537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25445497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	16904380, 19238537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	9531582	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	28029547, 28513139, 7643997		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	14727087, 17927572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	14727087	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	17927572, 19066596, 24627490, 30356079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	2366002, 33419059	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	31442913	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	40176047	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	7666462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★★★★★ ★☆☆☆☆ Found in Text Mining only
mixed gliomas	Glioma	CTD_human_DG	16904380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moderate intellectual disability	Mental retardation	BEFREE	21285140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	28987816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	25449331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis I	Mucopolysaccharidosis	Pubtator	38204164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis II	Mucopolysaccharidosis	BEFREE	29606503, 30064964, 30595526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	11096344, 29654211, 31693515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	20372806	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	26071562	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	9169496	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	10593570, 29773681	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	18205195		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	17570514, 18205195, 23962073, 27758818, 30050123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	17570514, 22582553, 9057652	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10773404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	Pubtator	33917391	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	26956814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10383894, 10492640, 10995873, 11299801, 11497259, 12118381, 12601391, 12625753, 15342917, 16508012, 17428703, 17927572, 19238537, 19308738, 20392994 View all (37 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12523938, 16539659, 19013457, 23178912, 31313541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	14742448, 31313541, 34011924	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegeneration with brain iron accumulation (NBIA)	Nephropathy with Pretibial Epidermolysis Bullosa and Deafness	BEFREE	29395073		★★★★★ ★☆☆☆☆ Found in Text Mining only
NEURODEGENERATION WITH BRAIN IRON ACCUMULATION 5	Neurodegeneration With Brain Iron Accumulation	BEFREE	28261264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31199881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27523281, 31411213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	CTD_human_DG	17062801, 20882379		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	29065180, 37646182	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	30909605		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Omenn Syndrome	Omenn Syndrome	CTD_human_DG	26642240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Orofacial Cleft 1	Orofacial cleft	Pubtator	29855589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	10091149, 30427936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	10091149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	35602340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	31484533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	31484533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	38186569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	9760993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28262749, 31185171		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	30676731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	26842750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	29271190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	18085726, 21384276, 21672570, 28987816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	23303856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	31705743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30552136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	9466567	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	22579050		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Porphyria Cutanea Tarda	Porphyria Cutanea Tarda	BEFREE	11260010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Porphyria Cutanea Tarda	Porphyria Cutanea Tarda	LHGDN	11929045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	23962073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	28656755, 29875008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	2582441, 27736268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	27436023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary immune deficiency disorder	immunodeficiency	BEFREE	26711111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15538718, 15833840, 27509031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20130467, 25080433, 37894914	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	33122053	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Protoporphyria Erythropoietic	Erythropoietic protoporphyria	Pubtator	30712775	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29291011, 8050820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	31838906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Willis-ekbom disease	Pubtator	21398376, 22929029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	BEFREE	30895312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	CTD_human_DG	16904380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	15354733, 23818062, 29742327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	3422406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31537145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	CTD_human_DG	26642240		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	29305826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	27907033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sporadic porphyria cutanea tarda	Porphyria Cutanea Tarda	BEFREE	11929045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	16788758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	1716421, 22159558, 24890018, 28756980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	16788758, 24435655, 30979011, 31078603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22252752, 22252753, 36635327	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	20234090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	25647178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12118381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34444760	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
STOMATOCYTOSIS I	Stomatocytosis	BEFREE	12750157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	37324938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	27736268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	27228385	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	29365317	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thalassemia Intermedia	Thalassemia	BEFREE	10468869, 17488680, 8952151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thalassemia Intermedia	Thalassemia	CTD_human_DG	16755567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thalassemia Minor	Thalassemia	CTD_human_DG	16755567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	BEFREE	2301380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	9935054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	17570514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	23593654, 28848040, 29427385, 31213851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28790402	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	15342917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29109300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34418989, 36562811	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	18217980, 30344797, 33671013, 36973995, 37486696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	27995606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin A Deficiency	Vitamin A Deficiency	BEFREE	31402145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	29216383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	25503078		★★★★★ ★☆☆☆☆ Found in Text Mining only

TFRC (transferrin receptor)