TFPI (tissue factor pathway inhibitor)

Gene

• Entrez ID: 7035
• Gene name: Tissue factor pathway inhibitor
• Gene symbol: TFPI
• Synonyms (NCBI Gene): EPI, LACI, TFI, TFPI1
• Chromosome: 2
• Chromosome location: 2q32.1
• Summary: This gene encodes a Kunitz-type serine protease inhibitor that regulates the tissue factor (TF)-dependent pathway of blood coagulation. The coagulation process initiates with the formation of a factor VIIa-TF complex, which proteolytically activates addit

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018341	hsa-miR-335-5p	Microarray	18185580
MIRT020797	hsa-miR-155-5p	Proteomics	18668040
MIRT021798	hsa-miR-132-3p	Microarray	17612493
MIRT025882	hsa-miR-7-5p	Microarray	17612493
MIRT025882	hsa-miR-7-5p	Microarray	19073608
MIRT027730	hsa-miR-98-5p	Microarray	19088304
MIRT031813	hsa-miR-16-5p	Proteomics	18668040
MIRT048954	hsa-miR-92a-3p	CLASH	23622248
MIRT515693	hsa-miR-4797-5p	PAR-CLIP	23446348
MIRT515692	hsa-miR-10a-5p	PAR-CLIP	23446348
MIRT515691	hsa-miR-10b-5p	PAR-CLIP	23446348
MIRT515690	hsa-miR-759	PAR-CLIP	23446348
MIRT515689	hsa-miR-6849-3p	PAR-CLIP	23446348
MIRT515688	hsa-miR-339-5p	PAR-CLIP	23446348
MIRT515687	hsa-miR-6742-3p	PAR-CLIP	23446348
MIRT515686	hsa-miR-4421	PAR-CLIP	23446348
MIRT515684	hsa-miR-5699-3p	PAR-CLIP	23446348
MIRT515685	hsa-miR-766-3p	PAR-CLIP	23446348
MIRT515683	hsa-miR-6776-5p	PAR-CLIP	23446348
MIRT515682	hsa-miR-4725-5p	PAR-CLIP	23446348
MIRT515681	hsa-miR-4481	PAR-CLIP	23446348
MIRT515680	hsa-miR-4745-5p	PAR-CLIP	23446348
MIRT515679	hsa-miR-661	PAR-CLIP	23446348
MIRT515678	hsa-miR-3649	PAR-CLIP	23446348
MIRT515677	hsa-miR-542-3p	PAR-CLIP	23446348
MIRT515676	hsa-miR-4648	PAR-CLIP	23446348
MIRT515675	hsa-miR-6512-3p	PAR-CLIP	23446348
MIRT515674	hsa-miR-6720-5p	PAR-CLIP	23446348
MIRT515673	hsa-miR-1262	PAR-CLIP	23446348
MIRT515672	hsa-miR-4701-3p	PAR-CLIP	23446348
MIRT515671	hsa-miR-6736-5p	PAR-CLIP	23446348
MIRT483102	hsa-miR-432-5p	PAR-CLIP	23592263
MIRT483101	hsa-miR-143-3p	PAR-CLIP	23592263
MIRT483100	hsa-miR-4770	PAR-CLIP	23592263
MIRT483099	hsa-miR-6088	PAR-CLIP	23592263
MIRT483098	hsa-miR-4708-5p	PAR-CLIP	23592263
MIRT483097	hsa-miR-1273f	PAR-CLIP	23592263
MIRT483096	hsa-miR-655-5p	PAR-CLIP	23592263
MIRT483095	hsa-miR-377-5p	PAR-CLIP	23592263
MIRT483094	hsa-miR-6086	PAR-CLIP	23592263
MIRT483093	hsa-miR-3689d	PAR-CLIP	23592263
MIRT483092	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT483091	hsa-miR-4443	PAR-CLIP	23592263
MIRT483090	hsa-miR-6515-5p	PAR-CLIP	23592263
MIRT483089	hsa-miR-653-5p	PAR-CLIP	23592263
MIRT445176	hsa-miR-4699-5p	PAR-CLIP	22100165
MIRT445177	hsa-miR-1225-3p	PAR-CLIP	22100165
MIRT445175	hsa-miR-1233-3p	PAR-CLIP	22100165
MIRT025882	hsa-miR-7-5p	PAR-CLIP	22100165
MIRT445174	hsa-miR-6077	PAR-CLIP	22100165
MIRT445173	hsa-miR-3652	PAR-CLIP	22100165
MIRT445172	hsa-miR-4430	PAR-CLIP	22100165
MIRT445171	hsa-miR-4492	PAR-CLIP	22100165
MIRT445170	hsa-miR-4498	PAR-CLIP	22100165
MIRT445168	hsa-miR-5001-5p	PAR-CLIP	22100165
MIRT445169	hsa-miR-762	PAR-CLIP	22100165
MIRT445167	hsa-miR-4489	PAR-CLIP	22100165
MIRT445166	hsa-miR-4283	PAR-CLIP	22100165
MIRT445165	hsa-miR-185-3p	PAR-CLIP	22100165
MIRT445164	hsa-miR-6807-5p	PAR-CLIP	22100165
MIRT445163	hsa-miR-1273e	PAR-CLIP	22100165
MIRT515693	hsa-miR-4797-5p	PAR-CLIP	23446348
MIRT515692	hsa-miR-10a-5p	PAR-CLIP	23446348
MIRT515691	hsa-miR-10b-5p	PAR-CLIP	23446348
MIRT515690	hsa-miR-759	PAR-CLIP	23446348
MIRT515689	hsa-miR-6849-3p	PAR-CLIP	23446348
MIRT515688	hsa-miR-339-5p	PAR-CLIP	23446348
MIRT515687	hsa-miR-6742-3p	PAR-CLIP	23446348
MIRT515686	hsa-miR-4421	PAR-CLIP	23446348
MIRT515684	hsa-miR-5699-3p	PAR-CLIP	23446348
MIRT515685	hsa-miR-766-3p	PAR-CLIP	23446348
MIRT515683	hsa-miR-6776-5p	PAR-CLIP	23446348
MIRT515682	hsa-miR-4725-5p	PAR-CLIP	23446348
MIRT515681	hsa-miR-4481	PAR-CLIP	23446348
MIRT515680	hsa-miR-4745-5p	PAR-CLIP	23446348
MIRT515679	hsa-miR-661	PAR-CLIP	23446348
MIRT515678	hsa-miR-3649	PAR-CLIP	23446348
MIRT515677	hsa-miR-542-3p	PAR-CLIP	23446348
MIRT515676	hsa-miR-4648	PAR-CLIP	23446348
MIRT515675	hsa-miR-6512-3p	PAR-CLIP	23446348
MIRT515674	hsa-miR-6720-5p	PAR-CLIP	23446348
MIRT515673	hsa-miR-1262	PAR-CLIP	23446348
MIRT515672	hsa-miR-4701-3p	PAR-CLIP	23446348
MIRT515671	hsa-miR-6736-5p	PAR-CLIP	23446348
MIRT483102	hsa-miR-432-5p	PAR-CLIP	23592263
MIRT483101	hsa-miR-143-3p	PAR-CLIP	23592263
MIRT483100	hsa-miR-4770	PAR-CLIP	23592263
MIRT483099	hsa-miR-6088	PAR-CLIP	23592263
MIRT483098	hsa-miR-4708-5p	PAR-CLIP	23592263
MIRT483097	hsa-miR-1273f	PAR-CLIP	23592263
MIRT483096	hsa-miR-655-5p	PAR-CLIP	23592263
MIRT483095	hsa-miR-377-5p	PAR-CLIP	23592263
MIRT483094	hsa-miR-6086	PAR-CLIP	23592263
MIRT483093	hsa-miR-3689d	PAR-CLIP	23592263
MIRT483092	hsa-miR-6851-5p	PAR-CLIP	23592263
MIRT483091	hsa-miR-4443	PAR-CLIP	23592263
MIRT483090	hsa-miR-6515-5p	PAR-CLIP	23592263
MIRT483089	hsa-miR-653-5p	PAR-CLIP	23592263
MIRT445176	hsa-miR-4699-5p	PAR-CLIP	22100165
MIRT445177	hsa-miR-1225-3p	PAR-CLIP	22100165
MIRT445175	hsa-miR-1233-3p	PAR-CLIP	22100165
MIRT025882	hsa-miR-7-5p	PAR-CLIP	22100165
MIRT445174	hsa-miR-6077	PAR-CLIP	22100165
MIRT445173	hsa-miR-3652	PAR-CLIP	22100165
MIRT445172	hsa-miR-4430	PAR-CLIP	22100165
MIRT445171	hsa-miR-4492	PAR-CLIP	22100165
MIRT445170	hsa-miR-4498	PAR-CLIP	22100165
MIRT445168	hsa-miR-5001-5p	PAR-CLIP	22100165
MIRT445169	hsa-miR-762	PAR-CLIP	22100165
MIRT445167	hsa-miR-4489	PAR-CLIP	22100165
MIRT445166	hsa-miR-4283	PAR-CLIP	22100165
MIRT445165	hsa-miR-185-3p	PAR-CLIP	22100165
MIRT445164	hsa-miR-6807-5p	PAR-CLIP	22100165
MIRT445163	hsa-miR-1273e	PAR-CLIP	22100165
MIRT1420673	hsa-miR-1276	CLIP-seq
MIRT1420674	hsa-miR-203	CLIP-seq
MIRT1420675	hsa-miR-300	CLIP-seq
MIRT1420676	hsa-miR-3148	CLIP-seq
MIRT1420677	hsa-miR-3190	CLIP-seq
MIRT1420678	hsa-miR-323b-5p	CLIP-seq
MIRT1420679	hsa-miR-3646	CLIP-seq
MIRT1420680	hsa-miR-380	CLIP-seq
MIRT1420681	hsa-miR-381	CLIP-seq
MIRT1420682	hsa-miR-4289	CLIP-seq
MIRT1420683	hsa-miR-4311	CLIP-seq
MIRT1420684	hsa-miR-4457	CLIP-seq
MIRT1420685	hsa-miR-4501	CLIP-seq
MIRT1420686	hsa-miR-4512	CLIP-seq
MIRT1420687	hsa-miR-4533	CLIP-seq
MIRT1420688	hsa-miR-4666-3p	CLIP-seq
MIRT1420689	hsa-miR-4747-5p	CLIP-seq
MIRT1420690	hsa-miR-4752	CLIP-seq
MIRT1420691	hsa-miR-513b	CLIP-seq
MIRT1420692	hsa-miR-522	CLIP-seq
MIRT1420693	hsa-miR-583	CLIP-seq
MIRT1420694	hsa-miR-587	CLIP-seq
MIRT1554550	hsa-miR-143	CLIP-seq
MIRT1554551	hsa-miR-24	CLIP-seq
MIRT1420675	hsa-miR-300	CLIP-seq
MIRT1554552	hsa-miR-338-5p	CLIP-seq
MIRT1554553	hsa-miR-3647-3p	CLIP-seq
MIRT1420681	hsa-miR-381	CLIP-seq
MIRT1554554	hsa-miR-4284	CLIP-seq
MIRT1554555	hsa-miR-431	CLIP-seq
MIRT1554556	hsa-miR-432	CLIP-seq
MIRT1554557	hsa-miR-4494	CLIP-seq
MIRT1420688	hsa-miR-4666-3p	CLIP-seq
MIRT1554558	hsa-miR-4714-5p	CLIP-seq
MIRT1554559	hsa-miR-4717-3p	CLIP-seq
MIRT1554560	hsa-miR-545	CLIP-seq
MIRT1554561	hsa-miR-653	CLIP-seq
MIRT2348330	hsa-miR-10a	CLIP-seq
MIRT2348331	hsa-miR-10b	CLIP-seq
MIRT1420673	hsa-miR-1276	CLIP-seq
MIRT2348332	hsa-miR-1322	CLIP-seq
MIRT2348333	hsa-miR-219-1-3p	CLIP-seq
MIRT2348334	hsa-miR-2467-3p	CLIP-seq
MIRT1420678	hsa-miR-323b-5p	CLIP-seq
MIRT2348335	hsa-miR-3678-3p	CLIP-seq
MIRT2348336	hsa-miR-4263	CLIP-seq
MIRT2348337	hsa-miR-4269	CLIP-seq
MIRT2348338	hsa-miR-4277	CLIP-seq
MIRT1420683	hsa-miR-4311	CLIP-seq
MIRT1420687	hsa-miR-4533	CLIP-seq
MIRT1420689	hsa-miR-4747-5p	CLIP-seq
MIRT2348339	hsa-miR-4775	CLIP-seq
MIRT2348340	hsa-miR-4793-3p	CLIP-seq
MIRT2348341	hsa-miR-4799-5p	CLIP-seq
MIRT2348342	hsa-miR-576-5p	CLIP-seq
MIRT1420693	hsa-miR-583	CLIP-seq
MIRT2348343	hsa-miR-590-3p	CLIP-seq
MIRT2348344	hsa-miR-7	CLIP-seq
MIRT2395691	hsa-miR-1914	CLIP-seq
MIRT2395692	hsa-miR-25	CLIP-seq
MIRT2395693	hsa-miR-3122	CLIP-seq
MIRT2395694	hsa-miR-32	CLIP-seq
MIRT2395695	hsa-miR-363	CLIP-seq
MIRT2395696	hsa-miR-367	CLIP-seq
MIRT2395697	hsa-miR-3689a-3p	CLIP-seq
MIRT2395698	hsa-miR-3689c	CLIP-seq
MIRT2395699	hsa-miR-3913-5p	CLIP-seq
MIRT2395700	hsa-miR-4505	CLIP-seq
MIRT2395701	hsa-miR-4679	CLIP-seq
MIRT2395702	hsa-miR-4728-5p	CLIP-seq
MIRT2395703	hsa-miR-4731-5p	CLIP-seq
MIRT2395704	hsa-miR-485-5p	CLIP-seq
MIRT1554561	hsa-miR-653	CLIP-seq
MIRT2395705	hsa-miR-767-5p	CLIP-seq
MIRT2395706	hsa-miR-92a	CLIP-seq
MIRT2395707	hsa-miR-92b	CLIP-seq
MIRT2348330	hsa-miR-10a	CLIP-seq
MIRT2348331	hsa-miR-10b	CLIP-seq
MIRT2433807	hsa-miR-1207-3p	CLIP-seq
MIRT2433808	hsa-miR-23a	CLIP-seq
MIRT2433809	hsa-miR-23b	CLIP-seq
MIRT2433810	hsa-miR-23c	CLIP-seq
MIRT2433811	hsa-miR-3137	CLIP-seq
MIRT2433812	hsa-miR-4427	CLIP-seq
MIRT2433813	hsa-miR-4642	CLIP-seq
MIRT2433814	hsa-miR-4711-5p	CLIP-seq
MIRT1554559	hsa-miR-4717-3p	CLIP-seq
MIRT2433815	hsa-miR-4718	CLIP-seq
MIRT2433816	hsa-miR-4720-5p	CLIP-seq
MIRT2433817	hsa-miR-4732-3p	CLIP-seq
MIRT2433818	hsa-miR-4790-3p	CLIP-seq
MIRT2433819	hsa-miR-4799-3p	CLIP-seq
MIRT2433820	hsa-miR-617	CLIP-seq
MIRT2395693	hsa-miR-3122	CLIP-seq
MIRT2461382	hsa-miR-3144-3p	CLIP-seq
MIRT2395697	hsa-miR-3689a-3p	CLIP-seq
MIRT2395698	hsa-miR-3689c	CLIP-seq
MIRT2395699	hsa-miR-3913-5p	CLIP-seq
MIRT2395700	hsa-miR-4505	CLIP-seq
MIRT2395702	hsa-miR-4728-5p	CLIP-seq
MIRT2395703	hsa-miR-4731-5p	CLIP-seq
MIRT2395704	hsa-miR-485-5p	CLIP-seq
MIRT2461383	hsa-miR-875-5p	CLIP-seq
MIRT2348330	hsa-miR-10a	CLIP-seq
MIRT2348331	hsa-miR-10b	CLIP-seq
MIRT2640951	hsa-miR-1179	CLIP-seq
MIRT2433807	hsa-miR-1207-3p	CLIP-seq
MIRT2640952	hsa-miR-1236	CLIP-seq
MIRT2640953	hsa-miR-1245	CLIP-seq
MIRT2640954	hsa-miR-1254	CLIP-seq
MIRT2640955	hsa-miR-1257	CLIP-seq
MIRT2640956	hsa-miR-1258	CLIP-seq
MIRT2640957	hsa-miR-1260	CLIP-seq
MIRT2640958	hsa-miR-1260b	CLIP-seq
MIRT2640959	hsa-miR-1270	CLIP-seq
MIRT2640960	hsa-miR-127-5p	CLIP-seq
MIRT2640961	hsa-miR-1278	CLIP-seq
MIRT2640962	hsa-miR-1279	CLIP-seq
MIRT2640963	hsa-miR-1283	CLIP-seq
MIRT2348332	hsa-miR-1322	CLIP-seq
MIRT2640964	hsa-miR-137	CLIP-seq
MIRT2640965	hsa-miR-138	CLIP-seq
MIRT2640966	hsa-miR-140-5p	CLIP-seq
MIRT1554550	hsa-miR-143	CLIP-seq
MIRT2640967	hsa-miR-147	CLIP-seq
MIRT2640968	hsa-miR-181a	CLIP-seq
MIRT2640969	hsa-miR-181b	CLIP-seq
MIRT2640970	hsa-miR-181c	CLIP-seq
MIRT2640971	hsa-miR-181d	CLIP-seq
MIRT2640972	hsa-miR-188-3p	CLIP-seq
MIRT2395691	hsa-miR-1914	CLIP-seq
MIRT2640973	hsa-miR-19a	CLIP-seq
MIRT2640974	hsa-miR-19b	CLIP-seq
MIRT2640975	hsa-miR-2054	CLIP-seq
MIRT2640976	hsa-miR-2114	CLIP-seq
MIRT2348333	hsa-miR-219-1-3p	CLIP-seq
MIRT2433808	hsa-miR-23a	CLIP-seq
MIRT2433809	hsa-miR-23b	CLIP-seq
MIRT2433810	hsa-miR-23c	CLIP-seq
MIRT1554551	hsa-miR-24	CLIP-seq
MIRT2348334	hsa-miR-2467-3p	CLIP-seq
MIRT2395692	hsa-miR-25	CLIP-seq
MIRT1420675	hsa-miR-300	CLIP-seq
MIRT2640977	hsa-miR-3116	CLIP-seq
MIRT2640978	hsa-miR-3117-3p	CLIP-seq
MIRT2640979	hsa-miR-3121-3p	CLIP-seq
MIRT2395693	hsa-miR-3122	CLIP-seq
MIRT2640980	hsa-miR-3129-3p	CLIP-seq
MIRT2640981	hsa-miR-3130-3p	CLIP-seq
MIRT2640982	hsa-miR-3136-5p	CLIP-seq
MIRT2433811	hsa-miR-3137	CLIP-seq
MIRT2640983	hsa-miR-3143	CLIP-seq
MIRT2461382	hsa-miR-3144-3p	CLIP-seq
MIRT2640984	hsa-miR-3149	CLIP-seq
MIRT2640985	hsa-miR-3152-3p	CLIP-seq
MIRT2640986	hsa-miR-3156-3p	CLIP-seq
MIRT2640987	hsa-miR-3161	CLIP-seq
MIRT2640988	hsa-miR-3163	CLIP-seq
MIRT2640989	hsa-miR-3169	CLIP-seq
MIRT2640990	hsa-miR-3173-3p	CLIP-seq
MIRT2640991	hsa-miR-3177-5p	CLIP-seq
MIRT2395694	hsa-miR-32	CLIP-seq
MIRT2640992	hsa-miR-3201	CLIP-seq
MIRT2640993	hsa-miR-325	CLIP-seq
MIRT2640994	hsa-miR-338-3p	CLIP-seq
MIRT1554552	hsa-miR-338-5p	CLIP-seq
MIRT2640995	hsa-miR-33a	CLIP-seq
MIRT2640996	hsa-miR-33b	CLIP-seq
MIRT2640997	hsa-miR-3606	CLIP-seq
MIRT2640998	hsa-miR-3609	CLIP-seq
MIRT2640999	hsa-miR-3613-3p	CLIP-seq
MIRT2641000	hsa-miR-3619-3p	CLIP-seq
MIRT2395695	hsa-miR-363	CLIP-seq
MIRT1420679	hsa-miR-3646	CLIP-seq
MIRT1554553	hsa-miR-3647-3p	CLIP-seq
MIRT2641001	hsa-miR-3650	CLIP-seq
MIRT2641002	hsa-miR-3662	CLIP-seq
MIRT2395696	hsa-miR-367	CLIP-seq
MIRT2348335	hsa-miR-3678-3p	CLIP-seq
MIRT2641003	hsa-miR-3686	CLIP-seq
MIRT2395697	hsa-miR-3689a-3p	CLIP-seq
MIRT2395698	hsa-miR-3689c	CLIP-seq
MIRT2641004	hsa-miR-370	CLIP-seq
MIRT1420681	hsa-miR-381	CLIP-seq
MIRT2395699	hsa-miR-3913-5p	CLIP-seq
MIRT2641005	hsa-miR-3942-3p	CLIP-seq
MIRT2641006	hsa-miR-3942-5p	CLIP-seq
MIRT2641007	hsa-miR-3973	CLIP-seq
MIRT2641008	hsa-miR-411	CLIP-seq
MIRT2641009	hsa-miR-412	CLIP-seq
MIRT2641010	hsa-miR-421	CLIP-seq
MIRT2641011	hsa-miR-4254	CLIP-seq
MIRT2641012	hsa-miR-4262	CLIP-seq
MIRT2348337	hsa-miR-4269	CLIP-seq
MIRT2641013	hsa-miR-4276	CLIP-seq
MIRT2641014	hsa-miR-4282	CLIP-seq
MIRT1554554	hsa-miR-4284	CLIP-seq
MIRT1420682	hsa-miR-4289	CLIP-seq
MIRT2641015	hsa-miR-4301	CLIP-seq
MIRT2641016	hsa-miR-4302	CLIP-seq
MIRT1554555	hsa-miR-431	CLIP-seq
MIRT1554556	hsa-miR-432	CLIP-seq
MIRT2641017	hsa-miR-4422	CLIP-seq
MIRT2641018	hsa-miR-4423-3p	CLIP-seq
MIRT2433812	hsa-miR-4427	CLIP-seq
MIRT2641019	hsa-miR-4428	CLIP-seq
MIRT2641020	hsa-miR-4434	CLIP-seq
MIRT2641021	hsa-miR-4439	CLIP-seq
MIRT1554557	hsa-miR-4494	CLIP-seq
MIRT2395700	hsa-miR-4505	CLIP-seq
MIRT2641022	hsa-miR-450b-5p	CLIP-seq
MIRT2641023	hsa-miR-4514	CLIP-seq
MIRT2641024	hsa-miR-4516	CLIP-seq
MIRT2641025	hsa-miR-4521	CLIP-seq
MIRT2641026	hsa-miR-4530	CLIP-seq
MIRT2641027	hsa-miR-4531	CLIP-seq
MIRT2433813	hsa-miR-4642	CLIP-seq
MIRT1420688	hsa-miR-4666-3p	CLIP-seq
MIRT2395701	hsa-miR-4679	CLIP-seq
MIRT2641028	hsa-miR-4684-5p	CLIP-seq
MIRT2641029	hsa-miR-4692	CLIP-seq
MIRT2641030	hsa-miR-4694-3p	CLIP-seq
MIRT2641031	hsa-miR-4699-3p	CLIP-seq
MIRT2641032	hsa-miR-4703-5p	CLIP-seq
MIRT2641033	hsa-miR-4709-5p	CLIP-seq
MIRT2433814	hsa-miR-4711-5p	CLIP-seq
MIRT1554559	hsa-miR-4717-3p	CLIP-seq
MIRT2433815	hsa-miR-4718	CLIP-seq
MIRT2433816	hsa-miR-4720-5p	CLIP-seq
MIRT2395702	hsa-miR-4728-5p	CLIP-seq
MIRT2395703	hsa-miR-4731-5p	CLIP-seq
MIRT2433817	hsa-miR-4732-3p	CLIP-seq
MIRT2641034	hsa-miR-4738-3p	CLIP-seq
MIRT2641035	hsa-miR-4742-5p	CLIP-seq
MIRT2641036	hsa-miR-4753-3p	CLIP-seq
MIRT2641037	hsa-miR-4759	CLIP-seq
MIRT2641038	hsa-miR-4764-3p	CLIP-seq
MIRT2641039	hsa-miR-4768-5p	CLIP-seq
MIRT2348339	hsa-miR-4775	CLIP-seq
MIRT2641040	hsa-miR-4776-5p	CLIP-seq
MIRT2641041	hsa-miR-4778-5p	CLIP-seq
MIRT2641042	hsa-miR-4779	CLIP-seq
MIRT2641043	hsa-miR-4782-5p	CLIP-seq
MIRT2641044	hsa-miR-4789-5p	CLIP-seq
MIRT2433818	hsa-miR-4790-3p	CLIP-seq
MIRT2641045	hsa-miR-4791	CLIP-seq
MIRT2348340	hsa-miR-4793-3p	CLIP-seq
MIRT2433819	hsa-miR-4799-3p	CLIP-seq
MIRT2641046	hsa-miR-4803	CLIP-seq
MIRT2395704	hsa-miR-485-5p	CLIP-seq
MIRT2641047	hsa-miR-494	CLIP-seq
MIRT2641048	hsa-miR-504	CLIP-seq
MIRT2641049	hsa-miR-508-5p	CLIP-seq
MIRT2641050	hsa-miR-511	CLIP-seq
MIRT2641051	hsa-miR-520g	CLIP-seq
MIRT2641052	hsa-miR-520h	CLIP-seq
MIRT2641053	hsa-miR-526b	CLIP-seq
MIRT2641054	hsa-miR-543	CLIP-seq
MIRT1554560	hsa-miR-545	CLIP-seq
MIRT2641055	hsa-miR-548ae	CLIP-seq
MIRT2641056	hsa-miR-548ah	CLIP-seq
MIRT2641057	hsa-miR-548aj	CLIP-seq
MIRT2641058	hsa-miR-548am	CLIP-seq
MIRT2641059	hsa-miR-548p	CLIP-seq
MIRT2641060	hsa-miR-548t	CLIP-seq
MIRT2641061	hsa-miR-548x	CLIP-seq
MIRT2641062	hsa-miR-552	CLIP-seq
MIRT2641063	hsa-miR-554	CLIP-seq
MIRT2641064	hsa-miR-562	CLIP-seq
MIRT2641065	hsa-miR-568	CLIP-seq
MIRT2641066	hsa-miR-570	CLIP-seq
MIRT2641067	hsa-miR-578	CLIP-seq
MIRT2641068	hsa-miR-579	CLIP-seq
MIRT1420694	hsa-miR-587	CLIP-seq
MIRT2348343	hsa-miR-590-3p	CLIP-seq
MIRT2641069	hsa-miR-605	CLIP-seq
MIRT2433820	hsa-miR-617	CLIP-seq
MIRT2641070	hsa-miR-620	CLIP-seq
MIRT2641071	hsa-miR-628-3p	CLIP-seq
MIRT1554561	hsa-miR-653	CLIP-seq
MIRT2641072	hsa-miR-654-3p	CLIP-seq
MIRT2641073	hsa-miR-670	CLIP-seq
MIRT2348344	hsa-miR-7	CLIP-seq
MIRT2641074	hsa-miR-766	CLIP-seq
MIRT2395705	hsa-miR-767-5p	CLIP-seq
MIRT2461383	hsa-miR-875-5p	CLIP-seq
MIRT2641075	hsa-miR-921	CLIP-seq
MIRT2395706	hsa-miR-92a	CLIP-seq
MIRT2395707	hsa-miR-92b	CLIP-seq
MIRT2641076	hsa-miR-940	CLIP-seq
MIRT2641077	hsa-miR-943	CLIP-seq
MIRT2641078	hsa-miR-944	CLIP-seq
MIRT2348330	hsa-miR-10a	CLIP-seq
MIRT2348331	hsa-miR-10b	CLIP-seq
MIRT2640951	hsa-miR-1179	CLIP-seq
MIRT2433807	hsa-miR-1207-3p	CLIP-seq
MIRT2640952	hsa-miR-1236	CLIP-seq
MIRT2640953	hsa-miR-1245	CLIP-seq
MIRT2640954	hsa-miR-1254	CLIP-seq
MIRT2640955	hsa-miR-1257	CLIP-seq
MIRT2640956	hsa-miR-1258	CLIP-seq
MIRT2640957	hsa-miR-1260	CLIP-seq
MIRT2640958	hsa-miR-1260b	CLIP-seq
MIRT2640959	hsa-miR-1270	CLIP-seq
MIRT2640960	hsa-miR-127-5p	CLIP-seq
MIRT2640961	hsa-miR-1278	CLIP-seq
MIRT2640962	hsa-miR-1279	CLIP-seq
MIRT2640963	hsa-miR-1283	CLIP-seq
MIRT2348332	hsa-miR-1322	CLIP-seq
MIRT2640964	hsa-miR-137	CLIP-seq
MIRT2640965	hsa-miR-138	CLIP-seq
MIRT2640966	hsa-miR-140-5p	CLIP-seq
MIRT2692934	hsa-miR-142-5p	CLIP-seq
MIRT1554550	hsa-miR-143	CLIP-seq
MIRT2640967	hsa-miR-147	CLIP-seq
MIRT2640968	hsa-miR-181a	CLIP-seq
MIRT2640969	hsa-miR-181b	CLIP-seq
MIRT2640970	hsa-miR-181c	CLIP-seq
MIRT2640971	hsa-miR-181d	CLIP-seq
MIRT2640972	hsa-miR-188-3p	CLIP-seq
MIRT2395691	hsa-miR-1914	CLIP-seq
MIRT2640973	hsa-miR-19a	CLIP-seq
MIRT2640974	hsa-miR-19b	CLIP-seq
MIRT2640975	hsa-miR-2054	CLIP-seq
MIRT2640976	hsa-miR-2114	CLIP-seq
MIRT2348333	hsa-miR-219-1-3p	CLIP-seq
MIRT2433808	hsa-miR-23a	CLIP-seq
MIRT2433809	hsa-miR-23b	CLIP-seq
MIRT2433810	hsa-miR-23c	CLIP-seq
MIRT1554551	hsa-miR-24	CLIP-seq
MIRT2348334	hsa-miR-2467-3p	CLIP-seq
MIRT2395692	hsa-miR-25	CLIP-seq
MIRT1420675	hsa-miR-300	CLIP-seq
MIRT2640977	hsa-miR-3116	CLIP-seq
MIRT2640978	hsa-miR-3117-3p	CLIP-seq
MIRT2640979	hsa-miR-3121-3p	CLIP-seq
MIRT2395693	hsa-miR-3122	CLIP-seq
MIRT2640980	hsa-miR-3129-3p	CLIP-seq
MIRT2640981	hsa-miR-3130-3p	CLIP-seq
MIRT2640982	hsa-miR-3136-5p	CLIP-seq
MIRT2433811	hsa-miR-3137	CLIP-seq
MIRT2640983	hsa-miR-3143	CLIP-seq
MIRT2461382	hsa-miR-3144-3p	CLIP-seq
MIRT2640984	hsa-miR-3149	CLIP-seq
MIRT2640985	hsa-miR-3152-3p	CLIP-seq
MIRT2640986	hsa-miR-3156-3p	CLIP-seq
MIRT2640987	hsa-miR-3161	CLIP-seq
MIRT2640988	hsa-miR-3163	CLIP-seq
MIRT2640989	hsa-miR-3169	CLIP-seq
MIRT2692935	hsa-miR-3171	CLIP-seq
MIRT2640990	hsa-miR-3173-3p	CLIP-seq
MIRT2640991	hsa-miR-3177-5p	CLIP-seq
MIRT2395694	hsa-miR-32	CLIP-seq
MIRT2640992	hsa-miR-3201	CLIP-seq
MIRT2640993	hsa-miR-325	CLIP-seq
MIRT2640994	hsa-miR-338-3p	CLIP-seq
MIRT1554552	hsa-miR-338-5p	CLIP-seq
MIRT2640995	hsa-miR-33a	CLIP-seq
MIRT2640996	hsa-miR-33b	CLIP-seq
MIRT2692936	hsa-miR-340	CLIP-seq
MIRT2640997	hsa-miR-3606	CLIP-seq
MIRT2640998	hsa-miR-3609	CLIP-seq
MIRT2640999	hsa-miR-3613-3p	CLIP-seq
MIRT2641000	hsa-miR-3619-3p	CLIP-seq
MIRT2395695	hsa-miR-363	CLIP-seq
MIRT1420679	hsa-miR-3646	CLIP-seq
MIRT1554553	hsa-miR-3647-3p	CLIP-seq
MIRT2641001	hsa-miR-3650	CLIP-seq
MIRT2692937	hsa-miR-3658	CLIP-seq
MIRT2641002	hsa-miR-3662	CLIP-seq
MIRT2395696	hsa-miR-367	CLIP-seq
MIRT2348335	hsa-miR-3678-3p	CLIP-seq
MIRT2641003	hsa-miR-3686	CLIP-seq
MIRT2395697	hsa-miR-3689a-3p	CLIP-seq
MIRT2395698	hsa-miR-3689c	CLIP-seq
MIRT2641004	hsa-miR-370	CLIP-seq
MIRT2692938	hsa-miR-371-5p	CLIP-seq
MIRT2692939	hsa-miR-371b-5p	CLIP-seq
MIRT1420681	hsa-miR-381	CLIP-seq
MIRT2395699	hsa-miR-3913-5p	CLIP-seq
MIRT2641005	hsa-miR-3942-3p	CLIP-seq
MIRT2641006	hsa-miR-3942-5p	CLIP-seq
MIRT2641007	hsa-miR-3973	CLIP-seq
MIRT2692940	hsa-miR-409-5p	CLIP-seq
MIRT2641008	hsa-miR-411	CLIP-seq
MIRT2641009	hsa-miR-412	CLIP-seq
MIRT2641010	hsa-miR-421	CLIP-seq
MIRT2641011	hsa-miR-4254	CLIP-seq
MIRT2641012	hsa-miR-4262	CLIP-seq
MIRT2692941	hsa-miR-4264	CLIP-seq
MIRT2348337	hsa-miR-4269	CLIP-seq
MIRT2641013	hsa-miR-4276	CLIP-seq
MIRT2641014	hsa-miR-4282	CLIP-seq
MIRT1554554	hsa-miR-4284	CLIP-seq
MIRT1420682	hsa-miR-4289	CLIP-seq
MIRT2641015	hsa-miR-4301	CLIP-seq
MIRT2641016	hsa-miR-4302	CLIP-seq
MIRT1554555	hsa-miR-431	CLIP-seq
MIRT1554556	hsa-miR-432	CLIP-seq
MIRT2641017	hsa-miR-4422	CLIP-seq
MIRT2641018	hsa-miR-4423-3p	CLIP-seq
MIRT2433812	hsa-miR-4427	CLIP-seq
MIRT2641019	hsa-miR-4428	CLIP-seq
MIRT2641020	hsa-miR-4434	CLIP-seq
MIRT2692942	hsa-miR-4438	CLIP-seq
MIRT2641021	hsa-miR-4439	CLIP-seq
MIRT1554557	hsa-miR-4494	CLIP-seq
MIRT2395700	hsa-miR-4505	CLIP-seq
MIRT2641022	hsa-miR-450b-5p	CLIP-seq
MIRT2641023	hsa-miR-4514	CLIP-seq
MIRT2641024	hsa-miR-4516	CLIP-seq
MIRT2641025	hsa-miR-4521	CLIP-seq
MIRT2641026	hsa-miR-4530	CLIP-seq
MIRT2641027	hsa-miR-4531	CLIP-seq
MIRT2433813	hsa-miR-4642	CLIP-seq
MIRT1420688	hsa-miR-4666-3p	CLIP-seq
MIRT2692943	hsa-miR-4666-5p	CLIP-seq
MIRT2395701	hsa-miR-4679	CLIP-seq
MIRT2641028	hsa-miR-4684-5p	CLIP-seq
MIRT2641029	hsa-miR-4692	CLIP-seq
MIRT2641030	hsa-miR-4694-3p	CLIP-seq
MIRT2641031	hsa-miR-4699-3p	CLIP-seq
MIRT2641032	hsa-miR-4703-5p	CLIP-seq
MIRT2641033	hsa-miR-4709-5p	CLIP-seq
MIRT2433814	hsa-miR-4711-5p	CLIP-seq
MIRT1554559	hsa-miR-4717-3p	CLIP-seq
MIRT2433815	hsa-miR-4718	CLIP-seq
MIRT2433816	hsa-miR-4720-5p	CLIP-seq
MIRT2395702	hsa-miR-4728-5p	CLIP-seq
MIRT2692944	hsa-miR-4729	CLIP-seq
MIRT2395703	hsa-miR-4731-5p	CLIP-seq
MIRT2433817	hsa-miR-4732-3p	CLIP-seq
MIRT2641034	hsa-miR-4738-3p	CLIP-seq
MIRT2692945	hsa-miR-4740-5p	CLIP-seq
MIRT2692946	hsa-miR-4742-3p	CLIP-seq
MIRT2641035	hsa-miR-4742-5p	CLIP-seq
MIRT2641036	hsa-miR-4753-3p	CLIP-seq
MIRT2641037	hsa-miR-4759	CLIP-seq
MIRT2641038	hsa-miR-4764-3p	CLIP-seq
MIRT2641039	hsa-miR-4768-5p	CLIP-seq
MIRT2348339	hsa-miR-4775	CLIP-seq
MIRT2641040	hsa-miR-4776-5p	CLIP-seq
MIRT2641041	hsa-miR-4778-5p	CLIP-seq
MIRT2641042	hsa-miR-4779	CLIP-seq
MIRT2641043	hsa-miR-4782-5p	CLIP-seq
MIRT2641044	hsa-miR-4789-5p	CLIP-seq
MIRT2433818	hsa-miR-4790-3p	CLIP-seq
MIRT2641045	hsa-miR-4791	CLIP-seq
MIRT2348340	hsa-miR-4793-3p	CLIP-seq
MIRT2692947	hsa-miR-4795-3p	CLIP-seq
MIRT2692948	hsa-miR-4797-3p	CLIP-seq
MIRT2433819	hsa-miR-4799-3p	CLIP-seq
MIRT2395704	hsa-miR-485-5p	CLIP-seq
MIRT2641047	hsa-miR-494	CLIP-seq
MIRT2692949	hsa-miR-498	CLIP-seq
MIRT2641048	hsa-miR-504	CLIP-seq
MIRT2641049	hsa-miR-508-5p	CLIP-seq
MIRT2692950	hsa-miR-5095	CLIP-seq
MIRT2641050	hsa-miR-511	CLIP-seq
MIRT2692951	hsa-miR-513c	CLIP-seq
MIRT2692952	hsa-miR-514b-5p	CLIP-seq
MIRT2641051	hsa-miR-520g	CLIP-seq
MIRT2641052	hsa-miR-520h	CLIP-seq
MIRT2641053	hsa-miR-526b	CLIP-seq
MIRT2641054	hsa-miR-543	CLIP-seq
MIRT1554560	hsa-miR-545	CLIP-seq
MIRT2641055	hsa-miR-548ae	CLIP-seq
MIRT2641056	hsa-miR-548ah	CLIP-seq
MIRT2641057	hsa-miR-548aj	CLIP-seq
MIRT2641058	hsa-miR-548am	CLIP-seq
MIRT2692953	hsa-miR-548c-3p	CLIP-seq
MIRT2641059	hsa-miR-548p	CLIP-seq
MIRT2641060	hsa-miR-548t	CLIP-seq
MIRT2641061	hsa-miR-548x	CLIP-seq
MIRT2641062	hsa-miR-552	CLIP-seq
MIRT2641063	hsa-miR-554	CLIP-seq
MIRT2692954	hsa-miR-556-3p	CLIP-seq
MIRT2641064	hsa-miR-562	CLIP-seq
MIRT2641065	hsa-miR-568	CLIP-seq
MIRT2641066	hsa-miR-570	CLIP-seq
MIRT2641067	hsa-miR-578	CLIP-seq
MIRT2641068	hsa-miR-579	CLIP-seq
MIRT2692955	hsa-miR-586	CLIP-seq
MIRT1420694	hsa-miR-587	CLIP-seq
MIRT2348343	hsa-miR-590-3p	CLIP-seq
MIRT2433820	hsa-miR-617	CLIP-seq
MIRT2641070	hsa-miR-620	CLIP-seq
MIRT2641071	hsa-miR-628-3p	CLIP-seq
MIRT2692956	hsa-miR-630	CLIP-seq
MIRT1554561	hsa-miR-653	CLIP-seq
MIRT2641072	hsa-miR-654-3p	CLIP-seq
MIRT2641073	hsa-miR-670	CLIP-seq
MIRT2348344	hsa-miR-7	CLIP-seq
MIRT2641074	hsa-miR-766	CLIP-seq
MIRT2395705	hsa-miR-767-5p	CLIP-seq
MIRT2461383	hsa-miR-875-5p	CLIP-seq
MIRT2641075	hsa-miR-921	CLIP-seq
MIRT2395706	hsa-miR-92a	CLIP-seq
MIRT2395707	hsa-miR-92b	CLIP-seq
MIRT2641076	hsa-miR-940	CLIP-seq
MIRT2641077	hsa-miR-943	CLIP-seq
MIRT2641078	hsa-miR-944	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004866	Function	Endopeptidase inhibitor activity	TAS	9252393
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IBA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	19065458
GO:0005615	Component	Extracellular space	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005901	Component	Caveola	IDA	21868574
GO:0007596	Process	Blood coagulation	IEA
GO:0007596	Process	Blood coagulation	TAS	9252393
GO:0007599	Process	Hemostasis	IEA
GO:0009986	Component	Cell surface	HDA	19581412
GO:0009986	Component	Cell surface	IDA	21868574
GO:0016020	Component	Membrane	IEA
GO:0030195	Process	Negative regulation of blood coagulation	IDA	21868574
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0071383	Process	Cellular response to steroid hormone stimulus	IEP	21868574
GO:0071396	Process	Cellular response to lipid	IEA
GO:0098552	Component	Side of membrane	IEA

Other IDs

• MIM: 152310
• HGNC: 11760
• e!Ensembl: ENSG00000003436

Protein

• UniProt ID: P10646
• Protein name: Tissue factor pathway inhibitor (TFPI) (Extrinsic pathway inhibitor) (EPI) (Lipoprotein-associated coagulation inhibitor) (LACI)
• Protein function: Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoprot
• PDB: 1ADZ, 1IRH, 1TFX, 4BQD, 4DTG, 5NMV, 6BX8, 7V1N
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00014	Kunitz_BPTI	53 → 105	Kunitz/Bovine pancreatic trypsin inhibitor domain	Domain
  PF00014	Kunitz_BPTI	124 → 176	Kunitz/Bovine pancreatic trypsin inhibitor domain	Domain
  PF00014	Kunitz_BPTI	216 → 268	Kunitz/Bovine pancreatic trypsin inhibitor domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Mostly in endothelial cells.
• Sequence:

  MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADD
  GPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQE
  KPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPN
  GFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIG
  KCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIF
  VKNM

• Sequence length: 304

Pathways

KEGG:

Complement and coagulation cascades

Reactome:

Extrinsic Pathway of Fibrin Clot Formation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARTHRITIS, JUVENILE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASEPTIC NECROSIS OF HEAD AND/OR NECK OF FEMUR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AVASCULAR NECROSIS OF BONE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISSEMINATED INTRAVASCULAR COAGULATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMOPHILIA A	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOXIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEONECROSIS OF MEDIAL FEMORAL CONDYLE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOPHILIA DUE TO ACTIVATED PROTEIN C RESISTANCE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOXIC SHOCK SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRANSIENT ISCHEMIC ATTACK	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Activated Protein C Resistance	Activated Protein C Resistance	CTD_human_DG	11703344		★☆☆☆☆ Found in Text Mining only
Activated Protein C Resistance	Activated Protein C Resistance	LHGDN	18067603		★☆☆☆☆ Found in Text Mining only
Activated Protein C Resistance	Activated Protein C Resistance	BEFREE	29317453		★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	BEFREE	17890962		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	10195910		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	10609650		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	24094893		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	31028190		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	31128863		★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	14640893	Stimulate	★☆☆☆☆ Found in Text Mining only
Angioedemas, Hereditary	Angioedema	BEFREE	30952698		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29899870		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	LHGDN	15339683		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	17762532, 30121005		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	20498653		★☆☆☆☆ Found in Text Mining only
Apraxias	Apraxia	BEFREE	31732959		★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial Occlusive Disease	LHGDN	18677291		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	15845911, 19713537, 27875740, 28749986, 30695687, 31616219		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	14522500, 19467658, 26826018, 28749986	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	14610342		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	19713537, 27875740, 28749986, 30695687, 31616219		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	28471981	Inhibit	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	36253349	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28249824		★☆☆☆☆ Found in Text Mining only
Beckwith-Wiedemann Syndrome	Beckwith-Wiedemann Syndrome	BEFREE	24704790		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	10072106, 11380428, 21895962, 26826018, 28716011	Inhibit	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	12117418, 25634741, 27977318		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	18695356, 25042561, 28749986, 28894953, 35014954, 35271862, 36142345, 40629026, 8652818	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	30298595		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17180732, 20062932, 20886581, 24785473, 25882602, 26598923, 27062696, 28734156		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21849050, 23071754, 23320987, 25407022, 25617766, 25849335, 25882602, 26598923, 26999003, 26999742	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	31028190		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11228343		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28246607		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24094893		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	26205296, 29773416, 30097651		★☆☆☆☆ Found in Text Mining only
Carotid Artery Thrombosis	Carotid artery thrombosis	Pubtator	21895962	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral Microangiopathy	BEFREE	28906205		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	17890962		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	29352692		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	24256036, 30599286		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	16919311		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	31555705		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	24481112, 26021375, 26112018, 27401985, 27917582, 28086816, 28088175, 28117377, 28165555, 28296256, 28392738, 28592280, 28693441, 28721320, 28898114, 29029600, 29070944, 29181788, 29187794, 29262858, 29416767, 29660234, 29948865, 30021692, 30081844, 30184233, 30402040, 30427947, 30504712, 30650090, 30851738, 30956091, 31070491, 31256154, 31336254, 31507533, 31579999		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28424613		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	26163243		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	23841464, 27662640		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	33725412	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	24966616	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	31038478	Stimulate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20062932, 26968713		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21621497, 26968713, 30103475, 9311608		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35477541	Associate	★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	29143997		★☆☆☆☆ Found in Text Mining only
Congenital Thrombotic Thrombocytopenic Purpura	Congenital Thrombotic Thrombocytopenic Purpura	CTD_human_DG	7740478		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30110680		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	10398162, 10959696, 27490645, 28716011, 28894953		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	10440909, 28716011, 28894953	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	10959696, 27490645, 28663071, 28716011, 28894953		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	19467658	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	10959696, 11684370, 25056722, 27490645, 28663071, 28716011, 28894953		★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	10440909	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	9141493	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary Thrombosis	Coronary Thrombosis	LHGDN	14656922		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	31038478	Stimulate	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	11380428, 17931693, 18600090, 20523161, 28246607, 28810169, 29196248		★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	CTD_human_DG	18480984		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	28906205		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28711195, 29416767, 30108152, 31473625		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	19467658	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21935671, 28716011	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28711195, 28716011, 29416767, 30108152, 31473625		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29331592		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	25531567		★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	18600090, 30296833		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Disseminated Intravascular Coagulation	Disseminated intravascular coagulation	Pubtator	24127605	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
East Texas bleeding disorder	Bleeding Disorder	BEFREE	23979154		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine System Diseases	BEFREE	31663293		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29357371, 30675751, 30921410		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	31028190		★☆☆☆☆ Found in Text Mining only
Erythromelalgia	Erythromelalgia	BEFREE	16138352		★☆☆☆☆ Found in Text Mining only
Exocrine pancreatic insufficiency	Exocrine pancreatic insufficiency	BEFREE	28526430, 29626359, 30298595, 31194745, 31435913		★☆☆☆☆ Found in Text Mining only
Eye Neoplasms	Eye Neoplasms	BEFREE	26022354		★☆☆☆☆ Found in Text Mining only
Factor V Deficiency	Factor v deficiency	Pubtator	18695002	Inhibit	★☆☆☆☆ Found in Text Mining only
Factor V Deficiency	Factor v deficiency	Pubtator	19861681	Associate	★☆☆☆☆ Found in Text Mining only
Factor VII Deficiency	Factor vii deficiency	Pubtator	35973191	Associate	★☆☆☆☆ Found in Text Mining only
Familial Thrombotic Thrombocytopenic Purpura	Thrombotic thrombocytopenic purpura	CTD_human_DG	7740478		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	27662640		★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Friedreich Ataxia	BEFREE	22744651		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33947134	Associate	★☆☆☆☆ Found in Text Mining only
gliosarcoma	Gliosarcoma	BEFREE	28744332		★☆☆☆☆ Found in Text Mining only
Gliosarcoma	Gliosarcoma	Pubtator	7485395	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	10200995	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	24466029		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	24466029	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	10885426	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30110680		★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	17978172, 22533488, 23763284, 26149025, 28516358, 28594458, 29317453, 29532595, 29571739, 29769259, 29845491, 29931593, 30093246, 30690836, 30755437, 31394258, 31608540		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemophilia B	Hemophilia	BEFREE	29317453, 31608540		★☆☆☆☆ Found in Text Mining only
Hemophilia, NOS	Hemophilia	BEFREE	22533488, 23763284, 26149025, 28516358, 28594458, 29532595, 29571739, 29845491, 29931593, 30093246, 30690836, 30755437, 31394258, 31608540		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	18695002, 19861681, 23979154, 34847292, 35973191	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhagic Disorders	Hemorrhagic disease	Pubtator	25634741	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	25882602	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Factor V Deficiency	Hereditary Factor V Deficiency	BEFREE	18695002		★☆☆☆☆ Found in Text Mining only
Homocystinuria	Homocystinuria	BEFREE	10828477		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	LHGDN	16380494		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	LHGDN	16380494		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	27878699		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26598923, 26826018	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	35309336	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Impaired cognition	Impaired Cognition	BEFREE	28424613, 28906205		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	31038478	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	17890962		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	31555705		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	LHGDN	14610342		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	31555705		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	16585865		★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh Syndrome	BEFREE	23010433, 25118196, 28916229		★☆☆☆☆ Found in Text Mining only
Leukomalacia, Periventricular	Periventricular Leukomalacia	BEFREE	28661514		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	2452157, 8029799		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	23841464, 27662640		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	BEFREE	2452157, 8029799		★☆☆☆☆ Found in Text Mining only
Lupus anticoagulant disorder	Lupus anticoagulant	BEFREE	16061602		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	31319876		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17180732, 20062932, 20886581, 24785473, 25882602, 26598923, 27062696, 28734156		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28246607		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24094893		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25669987, 28323036, 28631332, 31218387		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10885426, 17180732, 20062932, 23071754, 23320987, 24094893, 25882602, 26968713, 28356110, 31218387		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20062932, 26968713		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17180732		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25882602, 29108271		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12028585		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28923101		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	10885426		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	7485395	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	22410442, 23010433, 28916229, 30921410		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	30405097		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29758118		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	11389008, 21895962	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	14640893	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	16516912		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	28421636		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	LHGDN	11816723		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	26163243		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	35271862	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11507076, 16773181, 20886581, 21161326, 24094893, 25882602, 28058802, 29264878, 31513391, 31593811		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	29264878		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	LHGDN	17469034		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	30684113		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	11252653, 2353911		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28246607		★☆☆☆☆ Found in Text Mining only
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	BEFREE	22410442		★☆☆☆☆ Found in Text Mining only
Osteogenesis imperfecta type 3	Osteogenesis imperfecta	Pubtator	20378562, 20421270	Stimulate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24094893		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21071578	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	18261960		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	27982416		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	17762532, 30121005		★☆☆☆☆ Found in Text Mining only
Pontocerebellar Hypoplasia Type 6	Pontoneocerebellar hypoplasia	BEFREE	30921410		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	28906205		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25669987, 28323036, 28631332, 31218387		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32873277	Associate	★☆☆☆☆ Found in Text Mining only
Protein C Deficiency	Protein C Deficiency	BEFREE	29264878		★☆☆☆☆ Found in Text Mining only
Protein S Deficiency	Protein S Deficiency	BEFREE	20002538, 23841464		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29430733, 31616219		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21624643	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Edema	Pulmonary edema	Pubtator	18310227	Associate	★☆☆☆☆ Found in Text Mining only
Purpura, Thrombotic Thrombocytopenic	Thrombotic thrombocytopenic purpura	CTD_human_DG	7740478		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	LHGDN	18310227		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	29264361		★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	28661514		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	22304008		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15048639		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	2133217, 25407675, 31140293		★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	23894560		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	31812224		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	36253349	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28237365		★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	23894560		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	23894560		★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	27243342	Stimulate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	16138352, 27243342		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	17762532, 20002538, 20378562, 20421270, 23763284, 28111966, 28580443, 29097362, 29407626, 30093246, 30121005		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	Pubtator	17764874	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	11380428, 27243342, 34265605	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	28471981	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	32299435, 34115774	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	29899853		★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	29899853		★☆☆☆☆ Found in Text Mining only
Tomaculous neuropathy	Hereditary neuropathy with liability to pressure palsies	Pubtator	25634741, 33496735	Associate	★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	28916229		★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	29181660		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	26022354		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	33120861	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	19467658	Stimulate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	21868574	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	20431849	Inhibit	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	39365993	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	11380428, 18695356, 20431849, 21895962	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	24203351		★☆☆☆☆ Found in Text Mining only