Gene Gene information from NCBI Gene database.
Entrez ID 7033
Gene name Trefoil factor 3
Gene symbol TFF3
Synonyms (NCBI Gene)
ITFP1BTFI
Chromosome 21
Chromosome location 21q22.3
Summary Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are
miRNA miRNA information provided by mirtarbase database.
117
miRTarBase ID miRNA Experiments Reference
MIRT1420576 hsa-miR-1254 CLIP-seq
MIRT1420577 hsa-miR-1273f CLIP-seq
MIRT1420578 hsa-miR-143 CLIP-seq
MIRT1420579 hsa-miR-208a CLIP-seq
MIRT1420580 hsa-miR-208b CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
7
Transcription factor Regulation Reference
CDX2 Activation 17182120
CEBPB Unknown 12297725
ERG Unknown 21170267
NFKB1 Activation 12912861
NFKB1 Unknown 12297725
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 20423149, 25416956, 31658587, 32296183
GO:0005576 Component Extracellular region IDA 8454642
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600633 11757 ENSG00000160180
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q07654
Protein name Trefoil factor 3 (Intestinal trefoil factor) (hITF) (Polypeptide P1.B) (hP1.B)
Protein function Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen).
PDB 1E9T , 1PE3 , 6V1C
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00088 Trefoil 46 86 Trefoil (P-type) domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in goblet cells of the intestines and colon (at protein level). Expressed by goblet cells of small and large intestinal epithelia and also by the uterus. Also expressed in the hypothalamus where it is detected in paraventricu
Sequence
MKRVLSCVPEPTVVMAARALCMLGLVLALLSSSSAEEYVGLSANQCAVPAKDRVDCGYPH
VTPKECNNRGCCFDSRIPGVPWCFKP
LQEAECTF
Sequence length 94
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Estrogen-dependent gene expression
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
5
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
COLOR VISION DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
HEPATITIS, ANIMAL CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute Erythroblastic Leukemia Erythroblastic Leukemia BEFREE 10609650
★☆☆☆☆
Found in Text Mining only
Acute Kidney Insufficiency Acute Kidney Insufficiency CTD_human_DG 23052191
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 20332665
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 31685806
★☆☆☆☆
Found in Text Mining only
Adenoma Adenoma BEFREE 15083192, 17639052, 19394332
★☆☆☆☆
Found in Text Mining only
Adenoma of large intestine Colorectal adenoma BEFREE 28405143
★☆☆☆☆
Found in Text Mining only
Adenomatous Polyposis Coli Multiple polyposis syndrome BEFREE 9501226
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Rheumatoid arthritis Pubtator 31817054 Stimulate
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Rheumatoid arthritis Pubtator 36973646 Associate
★☆☆☆☆
Found in Text Mining only
Asthma Asthma Pubtator 33878997 Associate
★☆☆☆☆
Found in Text Mining only