TFF3 (trefoil factor 3)

Gene

• Entrez ID: 7033
• Gene name: Trefoil factor 3
• Gene symbol: TFF3
• Synonyms (NCBI Gene): ITF, P1B, TFI
• Chromosome: 21
• Chromosome location: 21q22.3
• Summary: Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1420576	hsa-miR-1254	CLIP-seq
MIRT1420577	hsa-miR-1273f	CLIP-seq
MIRT1420578	hsa-miR-143	CLIP-seq
MIRT1420579	hsa-miR-208a	CLIP-seq
MIRT1420580	hsa-miR-208b	CLIP-seq
MIRT1420581	hsa-miR-214	CLIP-seq
MIRT1420582	hsa-miR-298	CLIP-seq
MIRT1420583	hsa-miR-3116	CLIP-seq
MIRT1420584	hsa-miR-3155	CLIP-seq
MIRT1420585	hsa-miR-3155b	CLIP-seq
MIRT1420586	hsa-miR-3617	CLIP-seq
MIRT1420587	hsa-miR-3619-5p	CLIP-seq
MIRT1420588	hsa-miR-3649	CLIP-seq
MIRT1420589	hsa-miR-3913-3p	CLIP-seq
MIRT1420590	hsa-miR-4291	CLIP-seq
MIRT1420591	hsa-miR-4705	CLIP-seq
MIRT1420592	hsa-miR-4708-5p	CLIP-seq
MIRT1420593	hsa-miR-4770	CLIP-seq
MIRT1420594	hsa-miR-484	CLIP-seq
MIRT1420595	hsa-miR-499-5p	CLIP-seq
MIRT1420596	hsa-miR-515-3p	CLIP-seq
MIRT1420597	hsa-miR-519e	CLIP-seq
MIRT1420598	hsa-miR-550a	CLIP-seq
MIRT1420599	hsa-miR-641	CLIP-seq
MIRT1420600	hsa-miR-661	CLIP-seq
MIRT1420601	hsa-miR-761	CLIP-seq
MIRT1420602	hsa-miR-885-3p	CLIP-seq
MIRT1420603	hsa-miR-922	CLIP-seq
MIRT1420577	hsa-miR-1273f	CLIP-seq
MIRT2126311	hsa-miR-1285	CLIP-seq
MIRT2126312	hsa-miR-1304	CLIP-seq
MIRT1420578	hsa-miR-143	CLIP-seq
MIRT1420579	hsa-miR-208a	CLIP-seq
MIRT1420580	hsa-miR-208b	CLIP-seq
MIRT1420581	hsa-miR-214	CLIP-seq
MIRT1420582	hsa-miR-298	CLIP-seq
MIRT1420584	hsa-miR-3155	CLIP-seq
MIRT1420585	hsa-miR-3155b	CLIP-seq
MIRT2126313	hsa-miR-3187-5p	CLIP-seq
MIRT2126314	hsa-miR-320a	CLIP-seq
MIRT2126315	hsa-miR-320b	CLIP-seq
MIRT2126316	hsa-miR-320c	CLIP-seq
MIRT2126317	hsa-miR-320d	CLIP-seq
MIRT1420586	hsa-miR-3617	CLIP-seq
MIRT1420587	hsa-miR-3619-5p	CLIP-seq
MIRT1420588	hsa-miR-3649	CLIP-seq
MIRT1420589	hsa-miR-3913-3p	CLIP-seq
MIRT1420590	hsa-miR-4291	CLIP-seq
MIRT2126318	hsa-miR-4328	CLIP-seq
MIRT2126319	hsa-miR-4429	CLIP-seq
MIRT2126320	hsa-miR-4475	CLIP-seq
MIRT1420592	hsa-miR-4708-5p	CLIP-seq
MIRT1420593	hsa-miR-4770	CLIP-seq
MIRT2126321	hsa-miR-4771	CLIP-seq
MIRT2126322	hsa-miR-4780	CLIP-seq
MIRT1420594	hsa-miR-484	CLIP-seq
MIRT1420595	hsa-miR-499-5p	CLIP-seq
MIRT2126323	hsa-miR-518e	CLIP-seq
MIRT2126324	hsa-miR-612	CLIP-seq
MIRT1420599	hsa-miR-641	CLIP-seq
MIRT1420600	hsa-miR-661	CLIP-seq
MIRT2126325	hsa-miR-7	CLIP-seq
MIRT1420601	hsa-miR-761	CLIP-seq
MIRT1420603	hsa-miR-922	CLIP-seq
MIRT2126326	hsa-miR-938	CLIP-seq
MIRT2348302	hsa-miR-1207-3p	CLIP-seq
MIRT1420576	hsa-miR-1254	CLIP-seq
MIRT1420577	hsa-miR-1273f	CLIP-seq
MIRT2348303	hsa-miR-1273g	CLIP-seq
MIRT2348304	hsa-miR-140-5p	CLIP-seq
MIRT1420578	hsa-miR-143	CLIP-seq
MIRT1420579	hsa-miR-208a	CLIP-seq
MIRT1420580	hsa-miR-208b	CLIP-seq
MIRT1420581	hsa-miR-214	CLIP-seq
MIRT1420582	hsa-miR-298	CLIP-seq
MIRT1420583	hsa-miR-3116	CLIP-seq
MIRT2348305	hsa-miR-3135b	CLIP-seq
MIRT1420584	hsa-miR-3155	CLIP-seq
MIRT1420585	hsa-miR-3155b	CLIP-seq
MIRT2126314	hsa-miR-320a	CLIP-seq
MIRT2126315	hsa-miR-320b	CLIP-seq
MIRT2126316	hsa-miR-320c	CLIP-seq
MIRT2126317	hsa-miR-320d	CLIP-seq
MIRT2348306	hsa-miR-323b-5p	CLIP-seq
MIRT2348307	hsa-miR-324-5p	CLIP-seq
MIRT2348308	hsa-miR-3611	CLIP-seq
MIRT1420586	hsa-miR-3617	CLIP-seq
MIRT1420587	hsa-miR-3619-5p	CLIP-seq
MIRT1420588	hsa-miR-3649	CLIP-seq
MIRT2348309	hsa-miR-3689d	CLIP-seq
MIRT2348310	hsa-miR-3907	CLIP-seq
MIRT2348311	hsa-miR-3909	CLIP-seq
MIRT1420589	hsa-miR-3913-3p	CLIP-seq
MIRT1420590	hsa-miR-4291	CLIP-seq
MIRT2126318	hsa-miR-4328	CLIP-seq
MIRT2126319	hsa-miR-4429	CLIP-seq
MIRT2126320	hsa-miR-4475	CLIP-seq
MIRT2348312	hsa-miR-4511	CLIP-seq
MIRT2348313	hsa-miR-4693-3p	CLIP-seq
MIRT1420591	hsa-miR-4705	CLIP-seq
MIRT2348314	hsa-miR-4707-5p	CLIP-seq
MIRT1420592	hsa-miR-4708-5p	CLIP-seq
MIRT1420593	hsa-miR-4770	CLIP-seq
MIRT1420594	hsa-miR-484	CLIP-seq
MIRT2348315	hsa-miR-486-3p	CLIP-seq
MIRT1420595	hsa-miR-499-5p	CLIP-seq
MIRT1420596	hsa-miR-515-3p	CLIP-seq
MIRT2126323	hsa-miR-518e	CLIP-seq
MIRT1420597	hsa-miR-519e	CLIP-seq
MIRT1420598	hsa-miR-550a	CLIP-seq
MIRT2348316	hsa-miR-615-3p	CLIP-seq
MIRT1420599	hsa-miR-641	CLIP-seq
MIRT1420600	hsa-miR-661	CLIP-seq
MIRT2126325	hsa-miR-7	CLIP-seq
MIRT1420601	hsa-miR-761	CLIP-seq
MIRT1420602	hsa-miR-885-3p	CLIP-seq
MIRT1420603	hsa-miR-922	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CDX2	Activation	17182120
CEBPB	Unknown	12297725
ERG	Unknown	21170267
NFKB1	Activation	12912861
NFKB1	Unknown	12297725
RELA	Activation	12912861
RELA	Unknown	12297725

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	20423149, 25416956, 31658587, 32296183
GO:0005576	Component	Extracellular region	IDA	8454642
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0010906	Process	Regulation of glucose metabolic process	IEA
GO:0030141	Component	Secretory granule	IEA
GO:0030277	Process	Maintenance of gastrointestinal epithelium	IBA
GO:0042802	Function	Identical protein binding	IPI	20423149, 31658587

Other IDs

• MIM: 600633
• HGNC: 11757
• e!Ensembl: ENSG00000160180

Protein

• UniProt ID: Q07654
• Protein name: Trefoil factor 3 (Intestinal trefoil factor) (hITF) (Polypeptide P1.B) (hP1.B)
• Protein function: Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen).
• PDB: 1E9T, 1PE3, 6V1C
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00088	Trefoil	46 → 86	Trefoil (P-type) domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in goblet cells of the intestines and colon (at protein level). Expressed by goblet cells of small and large intestinal epithelia and also by the uterus. Also expressed in the hypothalamus where it is detected in paraventricu
• Sequence:

  MKRVLSCVPEPTVVMAARALCMLGLVLALLSSSSAEEYVGLSANQCAVPAKDRVDCGYPH
  VTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF

• Sequence length: 94

Pathways

Reactome:

Estrogen-dependent gene expression

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, ANIMAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOSITIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	10609650		★☆☆☆☆ Found in Text Mining only
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	23052191		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	20332665		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31685806		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	15083192, 17639052, 19394332		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	28405143		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	9501226		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	31817054	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	36973646	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	33878997	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	29747491	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28357579, 30397201		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	10190312, 19651633, 28238953, 30075763, 30831146, 30937155, 31235543, 31814330		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	10190312, 24550372, 25634542, 29084829, 29906417, 35437997, 35843173	Associate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	20112343		★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	LHGDN	12395334		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21170268, 24164280, 25266665, 25900183, 26559818, 28687783, 29088778, 29715436, 30451834, 30744593, 31658702, 8861832		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12671691, 15845533, 20132413, 22341453, 24058517, 24297604, 30431719, 30457247, 30744593, 35216615	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28687783	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16437709, 23329884, 24125969	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12210076, 15083192, 17639052, 19394332, 21520112		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30424721	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	22341453	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	24437456	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22246423		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35332126	Stimulate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	12452845		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28070169		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	21472131	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	24282531, 29850501, 29987860, 30337280		★☆☆☆☆ Found in Text Mining only
Cirrhosis, Cryptogenic	Cirrhosis	BEFREE	12395334		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	12912861, 15489957, 19238529, 31017261, 31562318		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	16924127, 23691218	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19635457, 23638081, 31432157		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	18979216		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10639160, 19394332, 19636011, 24125969, 25405728, 27760866, 28104986, 28405143, 30127975, 30611902, 31432157, 31835445, 9462243		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	10639160		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15665295		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24125969, 26307678, 28104986	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27760866, 31432157	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33210724	Inhibit	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	21472131		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	11358897, 23691218	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	20499178, 28104989, 30720187		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31817054		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	25691144		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	27232630	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29807366, 31211621		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29807366, 31211621		★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	29633639	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	25671298		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	24164280		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	18682706, 29100386		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	18682706		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	LHGDN	18682706		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	18682706		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	18682706	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	27330011		★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	35437997	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	10190312		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	18219111	Associate	★☆☆☆☆ Found in Text Mining only
ESTROGEN RESISTANCE	Estrogen Resistance	BEFREE	21170268		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29807366, 31211621		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	31101239		★☆☆☆☆ Found in Text Mining only
Fibrocystic Breast Disease	Breast fibrocystic disease	Pubtator	22341453	Stimulate	★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	15083192, 21520112, 22223087		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	18506086, 21520112		★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	39234749	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	23933418		★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	Pubtator	24282531	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	30075763, 30831146		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	12377807	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal inflammation	Gastrointestinal inflammation	BEFREE	24282531		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29100347, 29621542		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29100347		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29100347		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	29987860	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	LHGDN	16278592		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	28104989		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	36184749	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Failure Diastolic	Heart failure	Pubtator	36184749	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23455892, 24927122	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	29987860		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	24927122		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	24927122	Associate	★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	24228773	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Female	Female infertility	Pubtator	24228773	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	12297725, 23691218, 28627600, 30720187, 31494796		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	28627600	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	37299399	Inhibit	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	25800782, 28453457, 35843173	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	28622393		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	22998556	Stimulate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	29633639		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	29633639	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	20063012		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	CTD_human_DG	24863737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	33134397	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	23052191		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	BEFREE	29231123, 30394304		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver carcinoma	Liver carcinoma	BEFREE	15645121, 28445151, 30424721		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16110118		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	40224201	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22246423	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25997063, 34761591	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	33134397	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23329884, 24125969, 24358147, 28104986	Stimulate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	32974084	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	29100347		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24045095, 24164280, 25900183, 28687783, 29088778, 30744593, 8861832		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	12792801		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22246423		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19900447, 30956167		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15065094, 16467092, 20112343, 21170267, 24043589, 25748388, 28930171, 30139961, 31129769, 31563120		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12168114, 12210076, 15769482, 21769478, 23329884, 23933418, 25514872, 26240479, 27154568, 28453457, 29977284, 30039286		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	18198227, 21979329		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12881705, 21170267, 22246423, 24125969, 25405728, 28104986, 28445151, 28470574, 29088778, 29100347, 29212256, 30127975, 31432157		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19635457, 23638081, 31432157		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	BEFREE	21170268		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	12477053, 24164280, 25900183		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28923101		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	25691144		★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	LHGDN	16142311		★☆☆☆☆ Found in Text Mining only
Mucositis	Mucositis	Pubtator	28627600	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	32922167	Associate	★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	31699801		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	24733740		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	31683988	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	15578191		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12912861, 18506086, 19394332, 21170268, 23822993, 24713092, 25266665, 25514872, 27760866, 28405143, 28470574, 28687783, 30139961, 30519349, 31450568, 31563120		★☆☆☆☆ Found in Text Mining only
Nephritis Interstitial	Interstitial nephritis	Pubtator	29987860	Associate	★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	20063012		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31211621		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	31101239		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31211621		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	21170268, 26585578, 29088778		★☆☆☆☆ Found in Text Mining only
Oral Mucositis	Oral Mucositis	BEFREE	19636011		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	31817054	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21131918, 26780780, 28470574	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19900447, 30956167		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35332126	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	30956167		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	15515157, 15914279, 21520112, 22223087, 29534576, 30519349		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	22341453	Stimulate	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	26823779, 35833823	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	28666097		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	12395334		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	12395334		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15065094, 16467092, 20112343, 21170267, 24043589, 25748388, 28930171, 30139961, 31129769, 31563120		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15368473, 28930171	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21170267, 24043589, 25639219, 30139961, 34609407, 38256434	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	40224201	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	22516806		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	25199519, 31450568		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	25199519, 27626280, 31450568	Inhibit	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28673326, 31152257, 31817054		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	29028798	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	29028798		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	31685806		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	31812224		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29807366, 31211621		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12168114, 15769482, 21769478, 23329884, 23933418, 25514872, 26240479, 27154568, 28453457, 29977284, 30039286		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	16437709, 18593995, 18938748, 21487519, 23329884, 24358147, 24927122, 25514872, 26240479, 28453457, 29747491	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	23178499		★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	BEFREE	19636011		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	36696180	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	36465624	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	18198227, 21979329		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	22223087		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	15515157		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	18198227, 21520112, 21979329, 22223087		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	22223087	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	21979329, 22572548		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30335837		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36157217	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	16924127, 20461009, 30127975, 30720187, 31204414		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	39346086	Associate	★☆☆☆☆ Found in Text Mining only