NR2F2 (nuclear receptor subfamily 2 group F member 2)

Gene

• Entrez ID: 7026
• Gene name: Nuclear receptor subfamily 2 group F member 2
• Gene symbol: NR2F2
• Synonyms (NCBI Gene): ARP-1, ARP1, CHTD4, COUPTF2, COUPTFB, COUPTFII, NF-E3, SRXX5, SVP40, TFCOUP2
• Chromosome: 15
• Chromosome location: 15q26.2
• Summary: This gene encodes a member of the steroid thyroid hormone superfamily of nuclear receptors. The encoded protein is a ligand inducible transcription factor that is involved in the regulation of many different genes. Alternate splicing results in multiple t

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs587777371	C>A	Pathogenic	Coding sequence variant, missense variant
rs587777372	A>T	Pathogenic	Coding sequence variant, missense variant
rs587777374	G>A	Pathogenic	Splice donor variant
rs886041730	->G	Pathogenic	Frameshift variant, coding sequence variant
rs1555447237	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1555447465	G>C	Pathogenic	Missense variant, coding sequence variant
rs1596432295	TGCTTTG>-	Pathogenic	Coding sequence variant, frameshift variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006555	hsa-miR-302a-3p	Luciferase reporter assay, qRT-PCR, Western blot	21151097
MIRT006555	hsa-miR-302a-3p	Luciferase reporter assay, qRT-PCR, Western blot	21151097
MIRT006555	hsa-miR-302a-3p	Luciferase reporter assay, qRT-PCR, Western blot	21151097
MIRT027270	hsa-miR-101-3p	Sequencing	20371350
MIRT037296	hsa-miR-877-5p	CLASH	23622248
MIRT036667	hsa-miR-935	CLASH	23622248
MIRT036667	hsa-miR-935	CLASH	23622248
MIRT716947	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT655745	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT655744	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT655743	hsa-miR-2116-3p	HITS-CLIP	23824327
MIRT655742	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT655741	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT642002	hsa-miR-128-3p	HITS-CLIP	23824327
MIRT642001	hsa-miR-3681-3p	HITS-CLIP	23824327
MIRT642000	hsa-miR-216a-3p	HITS-CLIP	23824327
MIRT641999	hsa-miR-27b-3p	HITS-CLIP	23824327
MIRT641998	hsa-miR-27a-3p	HITS-CLIP	23824327
MIRT641997	hsa-miR-4645-3p	HITS-CLIP	23824327
MIRT641996	hsa-miR-513a-5p	HITS-CLIP	23824327
MIRT547307	hsa-miR-203a-3p	HITS-CLIP	23824327
MIRT641995	hsa-miR-510-3p	HITS-CLIP	23824327
MIRT073558	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT612719	hsa-miR-8485	HITS-CLIP	23824327
MIRT612718	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612717	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612716	hsa-miR-6793-3p	HITS-CLIP	23824327
MIRT574574	hsa-miR-520e	PAR-CLIP	20371350
MIRT574573	hsa-miR-302d-3p	PAR-CLIP	20371350
MIRT574572	hsa-miR-520d-3p	PAR-CLIP	20371350
MIRT574571	hsa-miR-373-3p	PAR-CLIP	20371350
MIRT574570	hsa-miR-520a-3p	PAR-CLIP	20371350
MIRT574569	hsa-miR-372-3p	PAR-CLIP	20371350
MIRT574568	hsa-miR-302e	PAR-CLIP	20371350
MIRT574567	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT574566	hsa-miR-302b-3p	PAR-CLIP	20371350
MIRT574565	hsa-miR-520b	PAR-CLIP	20371350
MIRT574564	hsa-miR-520c-3p	PAR-CLIP	20371350
MIRT006555	hsa-miR-302a-3p	PAR-CLIP	20371350
MIRT574563	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT574562	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT574561	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT073561	hsa-miR-4709-5p	PAR-CLIP	20371350
MIRT574560	hsa-miR-5189-3p	PAR-CLIP	20371350
MIRT073565	hsa-miR-409-3p	PAR-CLIP	21572407
MIRT073564	hsa-miR-144-3p	PAR-CLIP	21572407
MIRT027270	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT027270	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT471988	hsa-miR-548ac	PAR-CLIP	21572407
MIRT471987	hsa-miR-548bb-3p	PAR-CLIP	21572407
MIRT471986	hsa-miR-548d-3p	PAR-CLIP	21572407
MIRT471985	hsa-miR-548h-3p	PAR-CLIP	21572407
MIRT471984	hsa-miR-548z	PAR-CLIP	21572407
MIRT073569	hsa-miR-5680	PAR-CLIP	21572407
MIRT471983	hsa-miR-4684-3p	PAR-CLIP	21572407
MIRT471982	hsa-miR-582-5p	PAR-CLIP	21572407
MIRT073570	hsa-miR-7703	PAR-CLIP	21572407
MIRT073568	hsa-miR-4325	PAR-CLIP	21572407
MIRT073565	hsa-miR-409-3p	PAR-CLIP	21572407
MIRT471988	hsa-miR-548ac	PAR-CLIP	21572407
MIRT471987	hsa-miR-548bb-3p	PAR-CLIP	21572407
MIRT471986	hsa-miR-548d-3p	PAR-CLIP	21572407
MIRT471985	hsa-miR-548h-3p	PAR-CLIP	21572407
MIRT471984	hsa-miR-548z	PAR-CLIP	21572407
MIRT073569	hsa-miR-5680	PAR-CLIP	21572407
MIRT547307	hsa-miR-203a-3p	PAR-CLIP	21572407
MIRT471983	hsa-miR-4684-3p	PAR-CLIP	21572407
MIRT073563	hsa-let-7f-2-3p	PAR-CLIP	21572407
MIRT073567	hsa-miR-1185-1-3p	PAR-CLIP	21572407
MIRT073566	hsa-miR-1185-2-3p	PAR-CLIP	21572407
MIRT073570	hsa-miR-7703	PAR-CLIP	21572407
MIRT073568	hsa-miR-4325	PAR-CLIP	21572407
MIRT073565	hsa-miR-409-3p	PAR-CLIP	23592263
MIRT073564	hsa-miR-144-3p	PAR-CLIP	23592263
MIRT027270	hsa-miR-101-3p	PAR-CLIP	23592263
MIRT027270	hsa-miR-101-3p	PAR-CLIP	23592263
MIRT471988	hsa-miR-548ac	PAR-CLIP	23592263
MIRT471987	hsa-miR-548bb-3p	PAR-CLIP	23592263
MIRT471986	hsa-miR-548d-3p	PAR-CLIP	23592263
MIRT471985	hsa-miR-548h-3p	PAR-CLIP	23592263
MIRT471984	hsa-miR-548z	PAR-CLIP	23592263
MIRT073569	hsa-miR-5680	PAR-CLIP	23592263
MIRT471983	hsa-miR-4684-3p	PAR-CLIP	23592263
MIRT471982	hsa-miR-582-5p	PAR-CLIP	23592263
MIRT073570	hsa-miR-7703	PAR-CLIP	23592263
MIRT073568	hsa-miR-4325	PAR-CLIP	23592263
MIRT641999	hsa-miR-27b-3p	Luciferase reporter assay, qRT-PCR, Western blot	27844448
MIRT641999	hsa-miR-27b-3p	Luciferase reporter assay, qRT-PCR, Western blot	27844448
MIRT716947	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT655745	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT655744	hsa-miR-532-3p	HITS-CLIP	23824327
MIRT655743	hsa-miR-2116-3p	HITS-CLIP	23824327
MIRT655742	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT655741	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT642002	hsa-miR-128-3p	HITS-CLIP	23824327
MIRT642001	hsa-miR-3681-3p	HITS-CLIP	23824327
MIRT642000	hsa-miR-216a-3p	HITS-CLIP	23824327
MIRT641999	hsa-miR-27b-3p	HITS-CLIP	23824327
MIRT641998	hsa-miR-27a-3p	HITS-CLIP	23824327
MIRT641997	hsa-miR-4645-3p	HITS-CLIP	23824327
MIRT641996	hsa-miR-513a-5p	HITS-CLIP	23824327
MIRT547307	hsa-miR-203a-3p	HITS-CLIP	23824327
MIRT641995	hsa-miR-510-3p	HITS-CLIP	23824327
MIRT073558	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT612719	hsa-miR-8485	HITS-CLIP	23824327
MIRT612718	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612717	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612716	hsa-miR-6793-3p	HITS-CLIP	23824327
MIRT574574	hsa-miR-520e	PAR-CLIP	20371350
MIRT574573	hsa-miR-302d-3p	PAR-CLIP	20371350
MIRT574572	hsa-miR-520d-3p	PAR-CLIP	20371350
MIRT574571	hsa-miR-373-3p	PAR-CLIP	20371350
MIRT574570	hsa-miR-520a-3p	PAR-CLIP	20371350
MIRT574569	hsa-miR-372-3p	PAR-CLIP	20371350
MIRT574568	hsa-miR-302e	PAR-CLIP	20371350
MIRT574567	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT574566	hsa-miR-302b-3p	PAR-CLIP	20371350
MIRT574565	hsa-miR-520b	PAR-CLIP	20371350
MIRT574564	hsa-miR-520c-3p	PAR-CLIP	20371350
MIRT006555	hsa-miR-302a-3p	PAR-CLIP	20371350
MIRT574563	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT574562	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT574561	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT073561	hsa-miR-4709-5p	PAR-CLIP	20371350
MIRT574560	hsa-miR-5189-3p	PAR-CLIP	20371350
MIRT073565	hsa-miR-409-3p	PAR-CLIP	21572407
MIRT073564	hsa-miR-144-3p	PAR-CLIP	21572407
MIRT027270	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT027270	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT471988	hsa-miR-548ac	PAR-CLIP	21572407
MIRT471987	hsa-miR-548bb-3p	PAR-CLIP	21572407
MIRT471986	hsa-miR-548d-3p	PAR-CLIP	21572407
MIRT471985	hsa-miR-548h-3p	PAR-CLIP	21572407
MIRT471984	hsa-miR-548z	PAR-CLIP	21572407
MIRT073569	hsa-miR-5680	PAR-CLIP	21572407
MIRT471983	hsa-miR-4684-3p	PAR-CLIP	21572407
MIRT471982	hsa-miR-582-5p	PAR-CLIP	21572407
MIRT073570	hsa-miR-7703	PAR-CLIP	21572407
MIRT073568	hsa-miR-4325	PAR-CLIP	21572407
MIRT073565	hsa-miR-409-3p	PAR-CLIP	21572407
MIRT471988	hsa-miR-548ac	PAR-CLIP	21572407
MIRT471987	hsa-miR-548bb-3p	PAR-CLIP	21572407
MIRT471986	hsa-miR-548d-3p	PAR-CLIP	21572407
MIRT471985	hsa-miR-548h-3p	PAR-CLIP	21572407
MIRT471984	hsa-miR-548z	PAR-CLIP	21572407
MIRT073569	hsa-miR-5680	PAR-CLIP	21572407
MIRT547307	hsa-miR-203a-3p	PAR-CLIP	21572407
MIRT471983	hsa-miR-4684-3p	PAR-CLIP	21572407
MIRT073563	hsa-let-7f-2-3p	PAR-CLIP	21572407
MIRT073567	hsa-miR-1185-1-3p	PAR-CLIP	21572407
MIRT073566	hsa-miR-1185-2-3p	PAR-CLIP	21572407
MIRT073570	hsa-miR-7703	PAR-CLIP	21572407
MIRT073568	hsa-miR-4325	PAR-CLIP	21572407
MIRT073565	hsa-miR-409-3p	PAR-CLIP	23592263
MIRT073564	hsa-miR-144-3p	PAR-CLIP	23592263
MIRT027270	hsa-miR-101-3p	PAR-CLIP	23592263
MIRT027270	hsa-miR-101-3p	PAR-CLIP	23592263
MIRT471988	hsa-miR-548ac	PAR-CLIP	23592263
MIRT471987	hsa-miR-548bb-3p	PAR-CLIP	23592263
MIRT471986	hsa-miR-548d-3p	PAR-CLIP	23592263
MIRT471985	hsa-miR-548h-3p	PAR-CLIP	23592263
MIRT471984	hsa-miR-548z	PAR-CLIP	23592263
MIRT073569	hsa-miR-5680	PAR-CLIP	23592263
MIRT471983	hsa-miR-4684-3p	PAR-CLIP	23592263
MIRT471982	hsa-miR-582-5p	PAR-CLIP	23592263
MIRT073570	hsa-miR-7703	PAR-CLIP	23592263
MIRT073568	hsa-miR-4325	PAR-CLIP	23592263
MIRT1192487	hsa-miR-1245b-3p	CLIP-seq
MIRT1192488	hsa-miR-146a	CLIP-seq
MIRT1192489	hsa-miR-146b-5p	CLIP-seq
MIRT1192490	hsa-miR-155	CLIP-seq
MIRT1192491	hsa-miR-302a	CLIP-seq
MIRT1192492	hsa-miR-302b	CLIP-seq
MIRT1192493	hsa-miR-302c	CLIP-seq
MIRT1192494	hsa-miR-302d	CLIP-seq
MIRT1192495	hsa-miR-30a	CLIP-seq
MIRT1192496	hsa-miR-30b	CLIP-seq
MIRT1192497	hsa-miR-30c	CLIP-seq
MIRT1192498	hsa-miR-30d	CLIP-seq
MIRT1192499	hsa-miR-30e	CLIP-seq
MIRT1192500	hsa-miR-3130-3p	CLIP-seq
MIRT1192501	hsa-miR-3607-3p	CLIP-seq
MIRT1192502	hsa-miR-3686	CLIP-seq
MIRT1192503	hsa-miR-372	CLIP-seq
MIRT1192504	hsa-miR-373	CLIP-seq
MIRT1192505	hsa-miR-377	CLIP-seq
MIRT1192506	hsa-miR-4433	CLIP-seq
MIRT1192507	hsa-miR-4434	CLIP-seq
MIRT1192508	hsa-miR-4516	CLIP-seq
MIRT1192509	hsa-miR-4531	CLIP-seq
MIRT1192510	hsa-miR-4534	CLIP-seq
MIRT1192511	hsa-miR-4662a-3p	CLIP-seq
MIRT1192512	hsa-miR-4668-5p	CLIP-seq
MIRT1192513	hsa-miR-4680-5p	CLIP-seq
MIRT1192514	hsa-miR-4693-3p	CLIP-seq
MIRT1192515	hsa-miR-4705	CLIP-seq
MIRT1192516	hsa-miR-4717-3p	CLIP-seq
MIRT1192517	hsa-miR-4724-5p	CLIP-seq
MIRT1192518	hsa-miR-4728-3p	CLIP-seq
MIRT1192519	hsa-miR-4778-5p	CLIP-seq
MIRT1192520	hsa-miR-4793-3p	CLIP-seq
MIRT1192521	hsa-miR-4802-3p	CLIP-seq
MIRT1192522	hsa-miR-490-5p	CLIP-seq
MIRT1192523	hsa-miR-514	CLIP-seq
MIRT1192524	hsa-miR-514b-3p	CLIP-seq
MIRT1192525	hsa-miR-519a	CLIP-seq
MIRT1192526	hsa-miR-548g	CLIP-seq
MIRT1192527	hsa-miR-548n	CLIP-seq
MIRT1192528	hsa-miR-548t	CLIP-seq
MIRT1192529	hsa-miR-579	CLIP-seq
MIRT1192530	hsa-miR-586	CLIP-seq
MIRT1192531	hsa-miR-603	CLIP-seq
MIRT1192532	hsa-miR-618	CLIP-seq
MIRT1192533	hsa-miR-1236	CLIP-seq
MIRT1192487	hsa-miR-1245b-3p	CLIP-seq
MIRT1192534	hsa-miR-1252	CLIP-seq
MIRT1192535	hsa-miR-1323	CLIP-seq
MIRT1192488	hsa-miR-146a	CLIP-seq
MIRT1192489	hsa-miR-146b-5p	CLIP-seq
MIRT1192490	hsa-miR-155	CLIP-seq
MIRT1192491	hsa-miR-302a	CLIP-seq
MIRT1192492	hsa-miR-302b	CLIP-seq
MIRT1192493	hsa-miR-302c	CLIP-seq
MIRT1192494	hsa-miR-302d	CLIP-seq
MIRT1192536	hsa-miR-3065-5p	CLIP-seq
MIRT1192537	hsa-miR-3074-3p	CLIP-seq
MIRT1192500	hsa-miR-3130-3p	CLIP-seq
MIRT1192538	hsa-miR-3175	CLIP-seq
MIRT1192539	hsa-miR-3183	CLIP-seq
MIRT1192540	hsa-miR-3189-3p	CLIP-seq
MIRT1192501	hsa-miR-3607-3p	CLIP-seq
MIRT1192541	hsa-miR-362-5p	CLIP-seq
MIRT1192542	hsa-miR-3673	CLIP-seq
MIRT1192502	hsa-miR-3686	CLIP-seq
MIRT1192543	hsa-miR-369-3p	CLIP-seq
MIRT1192503	hsa-miR-372	CLIP-seq
MIRT1192504	hsa-miR-373	CLIP-seq
MIRT1192544	hsa-miR-374a	CLIP-seq
MIRT1192545	hsa-miR-374b	CLIP-seq
MIRT1192546	hsa-miR-374c	CLIP-seq
MIRT1192505	hsa-miR-377	CLIP-seq
MIRT1192547	hsa-miR-410	CLIP-seq
MIRT1192548	hsa-miR-4311	CLIP-seq
MIRT1192549	hsa-miR-4427	CLIP-seq
MIRT1192550	hsa-miR-4432	CLIP-seq
MIRT1192506	hsa-miR-4433	CLIP-seq
MIRT1192507	hsa-miR-4434	CLIP-seq
MIRT1192508	hsa-miR-4516	CLIP-seq
MIRT1192509	hsa-miR-4531	CLIP-seq
MIRT1192510	hsa-miR-4534	CLIP-seq
MIRT1192512	hsa-miR-4668-5p	CLIP-seq
MIRT1192551	hsa-miR-4680-3p	CLIP-seq
MIRT1192513	hsa-miR-4680-5p	CLIP-seq
MIRT1192552	hsa-miR-4691-5p	CLIP-seq
MIRT1192514	hsa-miR-4693-3p	CLIP-seq
MIRT1192515	hsa-miR-4705	CLIP-seq
MIRT1192516	hsa-miR-4717-3p	CLIP-seq
MIRT1192553	hsa-miR-4723-3p	CLIP-seq
MIRT1192554	hsa-miR-4723-5p	CLIP-seq
MIRT1192518	hsa-miR-4728-3p	CLIP-seq
MIRT1192555	hsa-miR-4728-5p	CLIP-seq
MIRT1192556	hsa-miR-4762-3p	CLIP-seq
MIRT1192557	hsa-miR-4775	CLIP-seq
MIRT1192519	hsa-miR-4778-5p	CLIP-seq
MIRT1192520	hsa-miR-4793-3p	CLIP-seq
MIRT1192558	hsa-miR-4795-3p	CLIP-seq
MIRT1192521	hsa-miR-4802-3p	CLIP-seq
MIRT1192522	hsa-miR-490-5p	CLIP-seq
MIRT1192559	hsa-miR-500b	CLIP-seq
MIRT1192560	hsa-miR-501-5p	CLIP-seq
MIRT1192561	hsa-miR-502-5p	CLIP-seq
MIRT1192562	hsa-miR-516a-3p	CLIP-seq
MIRT1192525	hsa-miR-519a	CLIP-seq
MIRT1192563	hsa-miR-520d-5p	CLIP-seq
MIRT1192564	hsa-miR-524-5p	CLIP-seq
MIRT1192527	hsa-miR-548n	CLIP-seq
MIRT1192565	hsa-miR-548o	CLIP-seq
MIRT1192528	hsa-miR-548t	CLIP-seq
MIRT1192566	hsa-miR-548u	CLIP-seq
MIRT1192529	hsa-miR-579	CLIP-seq
MIRT1192530	hsa-miR-586	CLIP-seq
MIRT1192531	hsa-miR-603	CLIP-seq
MIRT1192567	hsa-miR-655	CLIP-seq
MIRT1192568	hsa-miR-885-5p	CLIP-seq
MIRT1192542	hsa-miR-3673	CLIP-seq
MIRT1192547	hsa-miR-410	CLIP-seq
MIRT1192533	hsa-miR-1236	CLIP-seq
MIRT1192490	hsa-miR-155	CLIP-seq
MIRT1192539	hsa-miR-3183	CLIP-seq
MIRT1192540	hsa-miR-3189-3p	CLIP-seq
MIRT1192501	hsa-miR-3607-3p	CLIP-seq
MIRT1192542	hsa-miR-3673	CLIP-seq
MIRT1192502	hsa-miR-3686	CLIP-seq
MIRT1192547	hsa-miR-410	CLIP-seq
MIRT1192553	hsa-miR-4723-3p	CLIP-seq
MIRT2055932	hsa-miR-4778-3p	CLIP-seq
MIRT1192519	hsa-miR-4778-5p	CLIP-seq
MIRT1192561	hsa-miR-502-5p	CLIP-seq
MIRT1192527	hsa-miR-548n	CLIP-seq
MIRT1192528	hsa-miR-548t	CLIP-seq
MIRT1192566	hsa-miR-548u	CLIP-seq
MIRT1192530	hsa-miR-586	CLIP-seq
MIRT1192568	hsa-miR-885-5p	CLIP-seq
MIRT2055933	hsa-miR-300	CLIP-seq
MIRT1192540	hsa-miR-3189-3p	CLIP-seq
MIRT2055934	hsa-miR-381	CLIP-seq
MIRT2055935	hsa-miR-382	CLIP-seq
MIRT2055936	hsa-miR-451b	CLIP-seq
MIRT2055937	hsa-miR-4666-3p	CLIP-seq
MIRT1192556	hsa-miR-4762-3p	CLIP-seq
MIRT1192561	hsa-miR-502-5p	CLIP-seq
MIRT1192535	hsa-miR-1323	CLIP-seq
MIRT1192540	hsa-miR-3189-3p	CLIP-seq
MIRT1192561	hsa-miR-502-5p	CLIP-seq
MIRT1192565	hsa-miR-548o	CLIP-seq
MIRT1192533	hsa-miR-1236	CLIP-seq
MIRT1192539	hsa-miR-3183	CLIP-seq
MIRT1192553	hsa-miR-4723-3p	CLIP-seq
MIRT1192566	hsa-miR-548u	CLIP-seq
MIRT1192568	hsa-miR-885-5p	CLIP-seq
MIRT1192533	hsa-miR-1236	CLIP-seq
MIRT1192491	hsa-miR-302a	CLIP-seq
MIRT1192492	hsa-miR-302b	CLIP-seq
MIRT1192493	hsa-miR-302c	CLIP-seq
MIRT1192494	hsa-miR-302d	CLIP-seq
MIRT1192539	hsa-miR-3183	CLIP-seq
MIRT1192503	hsa-miR-372	CLIP-seq
MIRT1192504	hsa-miR-373	CLIP-seq
MIRT1192506	hsa-miR-4433	CLIP-seq
MIRT2391725	hsa-miR-4540	CLIP-seq
MIRT2391726	hsa-miR-4677-5p	CLIP-seq
MIRT1192553	hsa-miR-4723-3p	CLIP-seq
MIRT1192525	hsa-miR-519a	CLIP-seq
MIRT2391727	hsa-miR-554	CLIP-seq
MIRT1192568	hsa-miR-885-5p	CLIP-seq
MIRT1192533	hsa-miR-1236	CLIP-seq
MIRT1192539	hsa-miR-3183	CLIP-seq
MIRT1192553	hsa-miR-4723-3p	CLIP-seq
MIRT1192568	hsa-miR-885-5p	CLIP-seq
MIRT1192533	hsa-miR-1236	CLIP-seq
MIRT1192539	hsa-miR-3183	CLIP-seq
MIRT1192553	hsa-miR-4723-3p	CLIP-seq
MIRT1192568	hsa-miR-885-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	9343308, 19210544
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IMP	19210544
GO:0001701	Process	In utero embryonic development	IEA
GO:0001764	Process	Neuron migration	IEA
GO:0001893	Process	Maternal placenta development	IEA
GO:0001937	Process	Negative regulation of endothelial cell proliferation	IMP	19210544
GO:0001945	Process	Lymph vessel development	IEA
GO:0001972	Function	Retinoic acid binding	IBA
GO:0001972	Function	Retinoic acid binding	IDA	18798693
GO:0003084	Process	Positive regulation of systemic arterial blood pressure	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	9343308
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0004879	Function	Nuclear receptor activity	IDA	18798693
GO:0004879	Function	Nuclear receptor activity	TAS	1899293
GO:0005515	Function	Protein binding	IPI	18798693, 18815287, 19210544, 23201680, 28514442, 33961781
GO:0005634	Component	Nucleus	IDA	19210544
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	1899293
GO:0007399	Process	Nervous system development	IBA
GO:0007519	Process	Skeletal muscle tissue development	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008585	Process	Female gonad development	IMP	29478779
GO:0009566	Process	Fertilization	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0009956	Process	Radial pattern formation	IEA
GO:0010596	Process	Negative regulation of endothelial cell migration	IMP	19210544
GO:0030154	Process	Cell differentiation	IBA
GO:0030522	Process	Intracellular receptor signaling pathway	IEA
GO:0030900	Process	Forebrain development	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	18798693
GO:0043565	Function	Sequence-specific DNA binding	IDA	9343308
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	18798693
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	18815287
GO:0046872	Function	Metal ion binding	IEA
GO:0048514	Process	Blood vessel morphogenesis	IEA
GO:0060674	Process	Placenta blood vessel development	IEA
GO:0060707	Process	Trophoblast giant cell differentiation	IEA
GO:0060838	Process	Lymphatic endothelial cell fate commitment	IMP	18815287
GO:1900747	Process	Negative regulation of vascular endothelial growth factor signaling pathway	IMP	19210544
GO:1904936	Process	Interneuron migration	IEA

Other IDs

• MIM: 107773
• HGNC: 7976
• e!Ensembl: ENSG00000185551

Protein

• UniProt ID: P24468
• Protein name: COUP transcription factor 2 (COUP-TF2) (Apolipoprotein A-I regulatory protein 1) (ARP-1) (COUP transcription factor II) (COUP-TF II) (Nuclear receptor subfamily 2 group F member 2)
• Protein function: Ligand-activated transcription factor. Activated by high concentrations of 9-cis-retinoic acid and all-trans-retinoic acid, but not by dexamethasone, cortisol or progesterone (in vitro). Regulation of the apolipoprotein A-I gene transcription. B
• PDB: 3CJW
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00105	zf-C4	77 → 146	Zinc finger, C4 type (two domains)	Domain
  PF00104	Hormone_recep	197 → 387	Ligand-binding domain of nuclear hormone receptor	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Expressed in the stromal cells of developing fetal ovaries (PubMed:29478779). {ECO:0000269|PubMed:29478779}.
• Sequence:

  MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQ
  GGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRN
  CPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSG
  YISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITD
  QVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVE
  KLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF
  GKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ

• Sequence length: 414

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
46,xx sex reversal 5	Likely pathogenic; Pathogenic	rs2505780323, rs1899167019, rs1899167400	RCV003985956 RCV001171517 RCV001171518	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
46,XY disorder of sex development	Likely pathogenic	rs2141169336	RCV003482199	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Asplenia	Likely pathogenic; Pathogenic	rs587777371	RCV001729389	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Congenital heart defects, multiple types, 4	Likely pathogenic; Pathogenic	rs587777371, rs587777372, rs587777374, rs2141169116, rs2505774176, rs2505779992, rs886041730, rs2505774216, rs2505774507, rs1555447012, rs1555446983, rs1899172049, rs1899167019	RCV000116199 RCV000116200 RCV000116202 RCV001994474 RCV002472028 RCV003229944 RCV001171515 RCV003985172 RCV003986044 RCV000515135 RCV000660428 RCV001052373 RCV001171514	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
NR2F2 associated disorders	Likely pathogenic	rs2505780251, rs2505769438	RCV003311575 RCV003311576	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COMPLETE ATRIOVENTRICULAR CANAL DEFECT WITH VENTRICULAR HYPOPLASIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLETE ATRIOVENTRICULAR SEPTAL DEFECT WITH TETRALOGY OF FALLOT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLETE ATRIOVENTRICULAR SEPTAL DEFECT WITH VENTRICULAR HYPOPLASIA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLETE ATRIOVENTRICULAR SEPTAL DEFECT-TETRALOGY OF FALLOT	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFERTILITY, FEMALE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental disorder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NR2F2-related congenital heart defects	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NR2F2-related disorder	Uncertain significance; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TETRALOGY OF FALLOT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	9539779		★☆☆☆☆ Found in Text Mining only
Albinism, Oculocutaneous	Oculocutaneous albinism	BEFREE	17931990		★☆☆☆☆ Found in Text Mining only
Alternating hemiplegia of childhood	Alternating hemiplegia of childhood	Pubtator	31633027	Associate	★☆☆☆☆ Found in Text Mining only
Aortic coarctation	Aortic Coarctation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	21069739, 30529831		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	30929126		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	21069739, 30529831		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	30529831, 37039367	Associate	★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	30720060		★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	HPO_DG			★☆☆☆☆ Found in Text Mining only
Blepharophimosis Ptosis and Epicanthus Inversus	Blepharophimosis-ptosis-epicanthus inversus syndrome	Pubtator	29478779	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12525252, 19154418, 22966133, 25129343		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19154418, 20386594, 23292282, 24141032, 24513177, 32168782, 32631390	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36011369	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15289311, 29207189		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23690307		★☆☆☆☆ Found in Text Mining only
Cardiac defects	Cardiac Defects	BEFREE	29478779		★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular abnormalities	Pubtator	37039367	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	37039367	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	8782080		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	30409304		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25032732, 26800338, 28943908		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	19082449		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34070923	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular septal defect with ventricular hypoplasia	Complete Atrioventricular Septal Defect With Ventricular Hypoplasia	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Complete atrioventricular septal defect-tetralogy of Fallot	Complete Atrioventricular Septal Defect-Tetralogy Of Fallot	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	15750894, 19853750, 23165927, 24122781, 27363585, 29570242		★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	21172461, 24702954, 29222010, 29570242, 29663647		★☆☆☆☆ Found in Text Mining only
CONGENITAL HEART DEFECTS, MULTIPLE TYPES, 4	Congenital heart defects	UNIPROT_DG	24702954		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
CONGENITAL HEART DEFECTS, MULTIPLE TYPES, 4	Congenital heart defects	GENOMICS_ENGLAND_DG	24702954		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
CONGENITAL HEART DEFECTS, MULTIPLE TYPES, 4	Congenital heart defects	CLINVAR_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
CONGENITAL HEART DEFECTS, MULTIPLE TYPES, 4	Congenital heart defects	CTD_human_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Congenital hypoplasia of adrenal gland	Congenital adrenal hypoplasia	BEFREE	24295738		★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of lung	Pulmonary hypoplasia	BEFREE	19853750		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31368079		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	24702954, 29222010, 29866040		★☆☆☆☆ Found in Text Mining only
Double Outlet Right Ventricle	Double Outlet Right Ventricle	BEFREE	29222010, 29866040		★☆☆☆☆ Found in Text Mining only
Double Outlet Right Ventricle	Double outlet right ventricle	Pubtator	29866040	Associate	★☆☆☆☆ Found in Text Mining only
Double Outlet Right Ventricle	Double Outlet Right Ventricle	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	CLINVAR_DG	10215630, 15750894, 16251273, 18371933, 18798693, 21172461, 24702427, 24702954, 26633542, 28135719		★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	BEFREE	29663647		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	24141032	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	22138541		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15299092, 29982401		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	CTD_human_DG	22138541		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32707495, 33541291	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29928345, 30929126		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29928345, 30929126		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29928345, 30929126		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36980858	Associate	★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	27363585, 29478779, 29866040, 37039367	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	29478779, 32037394, 37039367	Associate	★☆☆☆☆ Found in Text Mining only
Heart Septal Defects Atrial	Congenital heart septal defect	Pubtator	27363585	Associate	★☆☆☆☆ Found in Text Mining only
Hypoplastic Left Heart Syndrome	Hypoplastic Left Heart Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	23925294		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	37898813	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	25800782	Associate	★☆☆☆☆ Found in Text Mining only
Intussusception	Intussusception	BEFREE	28859090		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	31000673	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31801919		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	1321332		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	1321332		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	19154418, 30592135	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12525252, 22966133, 25129343		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31158411		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15289311, 29207189		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23690307		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22293856, 26895100		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22966133, 23690307, 24295738, 24513177, 25129343, 26895100, 27844448, 28943908, 29207189, 29928345		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24513177		★☆☆☆☆ Found in Text Mining only
Maturity onset diabetes mellitus in young	Mason type diabetes	BEFREE	10331424		★☆☆☆☆ Found in Text Mining only
Maturity-Onset Diabetes of the Young, Type 1	Mason type diabetes	BEFREE	11435618		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	37015919	Associate	★☆☆☆☆ Found in Text Mining only
Multiple congenital anomalies	Multiple Congenital Anomalies	CLINVAR_DG	10215630, 15750894, 16251273, 18371933, 18798693, 21172461, 24702427, 24702954, 26633542, 28135719		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	26976208, 30701025, 31213901, 9454907		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25032732, 26800338, 30929126		★☆☆☆☆ Found in Text Mining only
Osteonecrosis	Osteonecrosis	Pubtator	31886265	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	16815388	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	23690307		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23690307	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	35513515	Associate	★☆☆☆☆ Found in Text Mining only
Partial atrioventricular canal	Partial atrioventricular canal defect	ORPHANET_DG	24702954		★☆☆☆☆ Found in Text Mining only
Partial defect of atrioventricular canal	Partial Defect Of Atrioventricular Canal	HPO_DG			★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22293856, 26895100		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23690307	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Venous Return Anomaly	Pulmonary Venous Return Anomaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31368079		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	37603355	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	31965022	Associate	★☆☆☆☆ Found in Text Mining only
Situs ambiguus	Situs ambiguus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 5	Spinocerebellar Ataxia	BEFREE	20603325		★☆☆☆☆ Found in Text Mining only
Subfertility, Female	Subfertility	CTD_human_DG	17590085		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of fallot	Pubtator	24479926	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tetralogy of Fallot	Tetralogy of Fallot	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thalassemia	Thalassemia	Pubtator	32107331	Stimulate	★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	HPO_DG			★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36451815	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	32469064	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	23704310		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	37039367	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	37039367	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	29222010		★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	HPO_DG			★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	30671724	Associate	★☆☆☆☆ Found in Text Mining only
X-linked Adrenal Hypoplasia	Adrenal Hypoplasia, X-Linked	BEFREE	24295738		★☆☆☆☆ Found in Text Mining only