TFAP4 (transcription factor AP-4)

Gene

• Entrez ID: 7023
• Gene name: Transcription factor AP-4
• Gene symbol: TFAP4
• Synonyms (NCBI Gene): AP-4, bHLHc41
• Chromosome: 16
• Chromosome location: 16p13.3
• Summary: Transcription factors of the basic helix-loop-helix-zipper (bHLH-ZIP) family contain a basic domain, which is used for DNA binding, and HLH and ZIP domains, which are used for oligomerization. Transcription factor AP4 activates both viral and cellular gen

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002538	hsa-miR-373-3p	Microarray	15685193
MIRT018094	hsa-miR-335-5p	Microarray	18185580
MIRT002538	hsa-miR-373-3p	Microarray;Other	15685193
MIRT022725	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT027354	hsa-miR-101-3p	Sequencing	20371350
MIRT031768	hsa-miR-16-5p	Proteomics	18668040
MIRT553688	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT027354	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT027354	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT553687	hsa-miR-583	PAR-CLIP	20371350
MIRT553686	hsa-miR-16-1-3p	PAR-CLIP	20371350
MIRT553685	hsa-miR-582-5p	PAR-CLIP	20371350
MIRT553688	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT027354	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT027354	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT553687	hsa-miR-583	PAR-CLIP	20371350
MIRT553686	hsa-miR-16-1-3p	PAR-CLIP	20371350
MIRT553685	hsa-miR-582-5p	PAR-CLIP	20371350
MIRT553673	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT553684	hsa-miR-520f-3p	PAR-CLIP	20371350
MIRT553683	hsa-miR-302d-3p	PAR-CLIP	20371350
MIRT553682	hsa-miR-302a-3p	PAR-CLIP	20371350
MIRT553681	hsa-miR-372-3p	PAR-CLIP	20371350
MIRT553680	hsa-miR-520e	PAR-CLIP	20371350
MIRT553679	hsa-miR-520d-3p	PAR-CLIP	20371350
MIRT553678	hsa-miR-520c-3p	PAR-CLIP	20371350
MIRT553677	hsa-miR-520b	PAR-CLIP	20371350
MIRT553676	hsa-miR-520a-3p	PAR-CLIP	20371350
MIRT002538	hsa-miR-373-3p	PAR-CLIP	20371350
MIRT553675	hsa-miR-302e	PAR-CLIP	20371350
MIRT553674	hsa-miR-302b-3p	PAR-CLIP	20371350
MIRT553673	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT553672	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT553671	hsa-miR-4428	PAR-CLIP	20371350
MIRT553670	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT553669	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT553668	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT553667	hsa-miR-4804-3p	PAR-CLIP	20371350
MIRT553666	hsa-miR-4720-3p	PAR-CLIP	20371350
MIRT553688	hsa-miR-144-3p	PAR-CLIP	21572407
MIRT027354	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT027354	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT553687	hsa-miR-583	PAR-CLIP	21572407
MIRT553686	hsa-miR-16-1-3p	PAR-CLIP	21572407
MIRT553685	hsa-miR-582-5p	PAR-CLIP	21572407
MIRT553673	hsa-miR-302c-3p	PAR-CLIP	21572407
MIRT553684	hsa-miR-520f-3p	PAR-CLIP	21572407
MIRT553683	hsa-miR-302d-3p	PAR-CLIP	21572407
MIRT553682	hsa-miR-302a-3p	PAR-CLIP	21572407
MIRT553681	hsa-miR-372-3p	PAR-CLIP	21572407
MIRT553680	hsa-miR-520e	PAR-CLIP	21572407
MIRT553679	hsa-miR-520d-3p	PAR-CLIP	21572407
MIRT553678	hsa-miR-520c-3p	PAR-CLIP	21572407
MIRT553677	hsa-miR-520b	PAR-CLIP	21572407
MIRT553676	hsa-miR-520a-3p	PAR-CLIP	21572407
MIRT002538	hsa-miR-373-3p	PAR-CLIP	21572407
MIRT553675	hsa-miR-302e	PAR-CLIP	21572407
MIRT553674	hsa-miR-302b-3p	PAR-CLIP	21572407
MIRT553673	hsa-miR-302c-3p	PAR-CLIP	21572407
MIRT553672	hsa-miR-548as-3p	PAR-CLIP	21572407
MIRT553671	hsa-miR-4428	PAR-CLIP	21572407
MIRT553670	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT553669	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT553668	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT553667	hsa-miR-4804-3p	PAR-CLIP	21572407
MIRT553666	hsa-miR-4720-3p	PAR-CLIP	21572407
MIRT735514	hsa-miR-608	PAR-CLIP	26701625
MIRT022725	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR	33717268
MIRT735514	hsa-miR-608	Luciferase reporter assay, Western blotting, qRT-PCR	31552102
MIRT022725	hsa-miR-124-3p	Western blotting, qRT-PCR	33717268
MIRT553688	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT027354	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT027354	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT553687	hsa-miR-583	PAR-CLIP	20371350
MIRT553686	hsa-miR-16-1-3p	PAR-CLIP	20371350
MIRT553685	hsa-miR-582-5p	PAR-CLIP	20371350
MIRT553688	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT027354	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT027354	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT553687	hsa-miR-583	PAR-CLIP	20371350
MIRT553686	hsa-miR-16-1-3p	PAR-CLIP	20371350
MIRT553685	hsa-miR-582-5p	PAR-CLIP	20371350
MIRT553673	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT553684	hsa-miR-520f-3p	PAR-CLIP	20371350
MIRT553683	hsa-miR-302d-3p	PAR-CLIP	20371350
MIRT553682	hsa-miR-302a-3p	PAR-CLIP	20371350
MIRT553681	hsa-miR-372-3p	PAR-CLIP	20371350
MIRT553680	hsa-miR-520e	PAR-CLIP	20371350
MIRT553679	hsa-miR-520d-3p	PAR-CLIP	20371350
MIRT553678	hsa-miR-520c-3p	PAR-CLIP	20371350
MIRT553677	hsa-miR-520b	PAR-CLIP	20371350
MIRT553676	hsa-miR-520a-3p	PAR-CLIP	20371350
MIRT002538	hsa-miR-373-3p	PAR-CLIP	20371350
MIRT553675	hsa-miR-302e	PAR-CLIP	20371350
MIRT553674	hsa-miR-302b-3p	PAR-CLIP	20371350
MIRT553673	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT553672	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT553671	hsa-miR-4428	PAR-CLIP	20371350
MIRT553670	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT553669	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT553668	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT553667	hsa-miR-4804-3p	PAR-CLIP	20371350
MIRT553666	hsa-miR-4720-3p	PAR-CLIP	20371350
MIRT553688	hsa-miR-144-3p	PAR-CLIP	21572407
MIRT027354	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT027354	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT553687	hsa-miR-583	PAR-CLIP	21572407
MIRT553686	hsa-miR-16-1-3p	PAR-CLIP	21572407
MIRT553685	hsa-miR-582-5p	PAR-CLIP	21572407
MIRT553673	hsa-miR-302c-3p	PAR-CLIP	21572407
MIRT553684	hsa-miR-520f-3p	PAR-CLIP	21572407
MIRT553683	hsa-miR-302d-3p	PAR-CLIP	21572407
MIRT553682	hsa-miR-302a-3p	PAR-CLIP	21572407
MIRT553681	hsa-miR-372-3p	PAR-CLIP	21572407
MIRT553680	hsa-miR-520e	PAR-CLIP	21572407
MIRT553679	hsa-miR-520d-3p	PAR-CLIP	21572407
MIRT553678	hsa-miR-520c-3p	PAR-CLIP	21572407
MIRT553677	hsa-miR-520b	PAR-CLIP	21572407
MIRT553676	hsa-miR-520a-3p	PAR-CLIP	21572407
MIRT002538	hsa-miR-373-3p	PAR-CLIP	21572407
MIRT553675	hsa-miR-302e	PAR-CLIP	21572407
MIRT553674	hsa-miR-302b-3p	PAR-CLIP	21572407
MIRT553673	hsa-miR-302c-3p	PAR-CLIP	21572407
MIRT553672	hsa-miR-548as-3p	PAR-CLIP	21572407
MIRT553671	hsa-miR-4428	PAR-CLIP	21572407
MIRT553670	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT553669	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT553668	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT553667	hsa-miR-4804-3p	PAR-CLIP	21572407
MIRT553666	hsa-miR-4720-3p	PAR-CLIP	21572407
MIRT1419975	hsa-miR-101	CLIP-seq
MIRT1419976	hsa-miR-1271	CLIP-seq
MIRT1419977	hsa-miR-1273f	CLIP-seq
MIRT1419978	hsa-miR-144	CLIP-seq
MIRT1419979	hsa-miR-15a	CLIP-seq
MIRT1419980	hsa-miR-15b	CLIP-seq
MIRT1419981	hsa-miR-16	CLIP-seq
MIRT1419982	hsa-miR-182	CLIP-seq
MIRT1419983	hsa-miR-195	CLIP-seq
MIRT1419984	hsa-miR-2110	CLIP-seq
MIRT1419985	hsa-miR-2116	CLIP-seq
MIRT1419986	hsa-miR-3140-3p	CLIP-seq
MIRT1419987	hsa-miR-3148	CLIP-seq
MIRT1419988	hsa-miR-3179	CLIP-seq
MIRT1419989	hsa-miR-3202	CLIP-seq
MIRT1419990	hsa-miR-339-5p	CLIP-seq
MIRT1419991	hsa-miR-424	CLIP-seq
MIRT1419992	hsa-miR-4271	CLIP-seq
MIRT1419993	hsa-miR-4311	CLIP-seq
MIRT1419994	hsa-miR-4677-5p	CLIP-seq
MIRT1419995	hsa-miR-4716-3p	CLIP-seq
MIRT1419996	hsa-miR-4723-5p	CLIP-seq
MIRT1419997	hsa-miR-4725-3p	CLIP-seq
MIRT1419998	hsa-miR-4728-5p	CLIP-seq
MIRT1419999	hsa-miR-4747-5p	CLIP-seq
MIRT1420000	hsa-miR-497	CLIP-seq
MIRT1420001	hsa-miR-545	CLIP-seq
MIRT1420002	hsa-miR-670	CLIP-seq
MIRT1420003	hsa-miR-96	CLIP-seq
MIRT1921315	hsa-miR-4446-3p	CLIP-seq
MIRT1921316	hsa-miR-4721	CLIP-seq
MIRT1921317	hsa-miR-4779	CLIP-seq
MIRT2126141	hsa-miR-342-5p	CLIP-seq
MIRT2126142	hsa-miR-369-3p	CLIP-seq
MIRT2126143	hsa-miR-374a	CLIP-seq
MIRT2126144	hsa-miR-374b	CLIP-seq
MIRT2126145	hsa-miR-3943	CLIP-seq
MIRT2126146	hsa-miR-4292	CLIP-seq
MIRT2126147	hsa-miR-4532	CLIP-seq
MIRT2126148	hsa-miR-4664-5p	CLIP-seq
MIRT2126149	hsa-miR-4691-5p	CLIP-seq
MIRT2126150	hsa-miR-516a-3p	CLIP-seq
MIRT2126151	hsa-miR-766	CLIP-seq
MIRT1419979	hsa-miR-15a	CLIP-seq
MIRT1419980	hsa-miR-15b	CLIP-seq
MIRT1419981	hsa-miR-16	CLIP-seq
MIRT1419983	hsa-miR-195	CLIP-seq
MIRT1419991	hsa-miR-424	CLIP-seq
MIRT1420000	hsa-miR-497	CLIP-seq
MIRT1420001	hsa-miR-545	CLIP-seq
MIRT2461332	hsa-miR-3661	CLIP-seq
MIRT2461333	hsa-miR-4254	CLIP-seq
MIRT2461334	hsa-miR-4786-5p	CLIP-seq
MIRT2461335	hsa-miR-619	CLIP-seq
MIRT2461336	hsa-miR-631	CLIP-seq
MIRT2461337	hsa-miR-769-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MYC	Activation	19270520

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	2833704, 14645924, 16540471
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	2833704
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	2833704
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IDA	9931457
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	16924111, 19505873, 25416956, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	7933101, 9931457, 11171123, 12663744, 19505873
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005739	Component	Mitochondrion	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	18818310
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0017053	Component	Transcription repressor complex	IEA
GO:0017053	Component	Transcription repressor complex	ISS
GO:0030330	Process	DNA damage response, signal transduction by p53 class mediator	IDA	18818310
GO:0042803	Function	Protein homodimerization activity	IPI	2123466
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0042826	Function	Histone deacetylase binding	IPI	16540471, 16924111
GO:0043065	Process	Positive regulation of apoptotic process	IDA	18818310
GO:0043392	Process	Negative regulation of DNA binding	IDA	7933101, 16540471
GO:0043565	Function	Sequence-specific DNA binding	IDA	2123466
GO:0043922	Process	Host-mediated suppression of viral transcription	IDA	14645924, 16540471
GO:0043922	Process	Host-mediated suppression of viral transcription	NAS	7933101
GO:0043923	Process	Host-mediated activation of viral transcription	IDA	2833704
GO:0045736	Process	Negative regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	18818310
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	9931457, 16924111, 19505873
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	18818310
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	12663744
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0065003	Process	Protein-containing complex assembly	IDA	19505873
GO:0065003	Process	Protein-containing complex assembly	IEA
GO:0070888	Function	E-box binding	IDA	7933101, 11171123, 12663744, 18818310, 19505873
GO:0070888	Function	E-box binding	IEA
GO:0071549	Process	Cellular response to dexamethasone stimulus	IEA
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	IDA	18818310
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 600743
• HGNC: 11745
• e!Ensembl: ENSG00000090447

Protein

• UniProt ID: Q01664
• Protein name: Transcription factor AP-4 (Activating enhancer-binding protein 4) (Class C basic helix-loop-helix protein 41) (bHLHc41)
• Protein function: Transcription factor that activates both viral and cellular genes by binding to the symmetrical DNA sequence 5'-CAGCTG-3'.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00010	HLH	49 → 100	Helix-loop-helix DNA-binding domain	Domain

• Sequence:

  MEYFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRR
  MQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQEL
  SGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLE
  AHMYPEKLKVIAQQVQLQQQQEQVRLLHQEKLEREQQQLRTQLLPPPAPTHHPTVIVPAP
  PPPPSHHINVVTMGPSSVINSVSTSRQNLDTIVQAIQHIEGTQEKQELEEEQRRAVIVKP
  VRSCPEAPTSDTASDSEASDSDAMDQSREEPSGDGELP

• Sequence length: 338

Pathways

KEGG:

Proteoglycans in cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	20230749, 20580132, 24498434	Associate	★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Primary Microcephaly	Primary microcephaly	Pubtator	28464862	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18818310, 19619298, 21719561	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	28465297	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	29132323		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22615908, 29132323, 33373169	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23055200, 25195135, 30026867, 31281549, 35001801	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	20972249	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	24065543		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	28742206	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23752226, 28912857, 29725460, 29906744		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18818310, 30541550	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	25552650, 28464862	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	20972249, 32285480, 32979048	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	20972249, 26756312, 28464862	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23055200, 30026867		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28981098	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21336989, 28078605, 29845218, 31186793		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28195176		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	20972249, 28464862	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23055200, 29725460		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	27448979	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	29880876		★☆☆☆☆ Found in Text Mining only
Paraplegia	Paraplegia	Pubtator	25552650, 32285480	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28981098, 36891298	Associate	★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	25552650	Associate	★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia Hereditary	Hereditary spastic paraplegia	Pubtator	23472171, 31525725, 32166732, 32979048, 36226339	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21336989, 28078605, 29845218, 31186793		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22615908, 28078605	Associate	★☆☆☆☆ Found in Text Mining only