Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	7019
Gene name	Transcription factor A, mitochondrial
Gene symbol	TFAM
Synonyms (NCBI Gene)	MTDPS15MTTF1MTTFATCF6TCF6L1TCF6L2TCF6L3
Chromosome	10
Chromosome location	10q21.1
Summary	This gene encodes a key mitochondrial transcription factor containing two high mobility group motifs. The encoded protein also functions in mitochondrial DNA replication and repair. Sequence polymorphisms in this gene are associated with Alzheimer`s and P

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs757075712	C>T	Likely-pathogenic, pathogenic	Non coding transcript variant, coding sequence variant, downstream transcript variant, missense variant, intron variant, genic downstream transcript variant

415

Show/Hide all (415)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050062	hsa-miR-26a-5p	CLASH	23622248
MIRT049528	hsa-miR-92a-3p	CLASH	23622248
MIRT049528	hsa-miR-92a-3p	CLASH	23622248
MIRT047391	hsa-miR-34a-5p	CLASH	23622248
MIRT041703	hsa-miR-484	CLASH	23622248
MIRT038986	hsa-miR-15a-3p	CLASH	23622248
MIRT053166	hsa-miR-200a-3p	Luciferase reporter assayWestern blot	24684598
MIRT054314	hsa-miR-494-3p	Luciferase reporter assayMicroarrayqRT-PCR	23047984
MIRT466459	hsa-miR-3609	HITS-CLIP	21572407
MIRT466460	hsa-miR-548ah-5p	HITS-CLIP	21572407
MIRT466458	hsa-miR-106a-5p	HITS-CLIP	21572407
MIRT466457	hsa-miR-106b-5p	HITS-CLIP	21572407
MIRT466456	hsa-miR-17-5p	HITS-CLIP	21572407
MIRT466455	hsa-miR-20a-5p	HITS-CLIP	21572407
MIRT466454	hsa-miR-20b-5p	HITS-CLIP	21572407
MIRT466453	hsa-miR-519d-3p	HITS-CLIP	21572407
MIRT466452	hsa-miR-526b-3p	HITS-CLIP	21572407
MIRT466451	hsa-miR-93-5p	HITS-CLIP	21572407
MIRT466450	hsa-miR-4796-3p	HITS-CLIP	21572407
MIRT466449	hsa-miR-3912-3p	HITS-CLIP	21572407
MIRT466448	hsa-miR-519a-3p	HITS-CLIP	21572407
MIRT466447	hsa-miR-519b-3p	HITS-CLIP	21572407
MIRT466446	hsa-miR-519c-3p	HITS-CLIP	21572407
MIRT466445	hsa-miR-101-5p	HITS-CLIP	21572407
MIRT466444	hsa-miR-142-5p	HITS-CLIP	21572407
MIRT466443	hsa-miR-5590-3p	HITS-CLIP	21572407
MIRT466442	hsa-miR-4677-3p	HITS-CLIP	21572407
MIRT466441	hsa-miR-4679	HITS-CLIP	21572407
MIRT466440	hsa-miR-4424	HITS-CLIP	21572407
MIRT466439	hsa-miR-337-3p	HITS-CLIP	21572407
MIRT466437	hsa-miR-448	HITS-CLIP	21572407
MIRT630549	hsa-miR-8485	HITS-CLIP	23824327
MIRT652751	hsa-miR-6767-3p	HITS-CLIP	23824327
MIRT652750	hsa-miR-8064	HITS-CLIP	23824327
MIRT621851	hsa-miR-4432	HITS-CLIP	23824327
MIRT621850	hsa-miR-8087	HITS-CLIP	23824327
MIRT630549	hsa-miR-8485	HITS-CLIP	23824327
MIRT621849	hsa-miR-4719	HITS-CLIP	23824327
MIRT652751	hsa-miR-6767-3p	HITS-CLIP	23824327
MIRT652750	hsa-miR-8064	HITS-CLIP	23824327
MIRT621848	hsa-miR-499a-5p	HITS-CLIP	23824327
MIRT621849	hsa-miR-4719	HITS-CLIP	23824327
MIRT652751	hsa-miR-6767-3p	HITS-CLIP	23824327
MIRT652750	hsa-miR-8064	HITS-CLIP	23824327
MIRT621851	hsa-miR-4432	HITS-CLIP	23824327
MIRT621850	hsa-miR-8087	HITS-CLIP	23824327
MIRT630549	hsa-miR-8485	HITS-CLIP	23824327
MIRT621849	hsa-miR-4719	HITS-CLIP	23824327
MIRT621848	hsa-miR-499a-5p	HITS-CLIP	23824327
MIRT630548	hsa-miR-6083	HITS-CLIP	23824327
MIRT621851	hsa-miR-4432	HITS-CLIP	23824327
MIRT621850	hsa-miR-8087	HITS-CLIP	23824327
MIRT621849	hsa-miR-4719	HITS-CLIP	23824327
MIRT621848	hsa-miR-499a-5p	HITS-CLIP	23824327
MIRT466459	hsa-miR-3609	PAR-CLIP	20371350
MIRT466460	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT466458	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT466457	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT466456	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT466455	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT466454	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT466453	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT466452	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT466451	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT466450	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT466449	hsa-miR-3912-3p	PAR-CLIP	20371350
MIRT466448	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT466447	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT466446	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT466445	hsa-miR-101-5p	PAR-CLIP	20371350
MIRT466444	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT466443	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT466442	hsa-miR-4677-3p	PAR-CLIP	20371350
MIRT466441	hsa-miR-4679	PAR-CLIP	20371350
MIRT466440	hsa-miR-4424	PAR-CLIP	20371350
MIRT466439	hsa-miR-337-3p	PAR-CLIP	20371350
MIRT466437	hsa-miR-448	PAR-CLIP	20371350
MIRT526413	hsa-miR-6871-5p	PAR-CLIP	22012620
MIRT526412	hsa-miR-3690	PAR-CLIP	22012620
MIRT526411	hsa-miR-4254	PAR-CLIP	22012620
MIRT526410	hsa-miR-6128	PAR-CLIP	22012620
MIRT526409	hsa-miR-1-3p	PAR-CLIP	22012620
MIRT526408	hsa-miR-206	PAR-CLIP	22012620
MIRT526407	hsa-miR-613	PAR-CLIP	22012620
MIRT526406	hsa-miR-6878-5p	PAR-CLIP	22012620
MIRT526405	hsa-miR-6731-5p	PAR-CLIP	22012620
MIRT526404	hsa-miR-8085	PAR-CLIP	22012620
MIRT526403	hsa-miR-1343-3p	PAR-CLIP	22012620
MIRT526402	hsa-miR-6783-3p	PAR-CLIP	22012620
MIRT526401	hsa-miR-30c-1-3p	PAR-CLIP	22012620
MIRT526400	hsa-miR-30c-2-3p	PAR-CLIP	22012620
MIRT526399	hsa-miR-6788-5p	PAR-CLIP	22012620
MIRT526398	hsa-miR-2054	PAR-CLIP	22012620
MIRT466459	hsa-miR-3609	PAR-CLIP	23446348
MIRT466460	hsa-miR-548ah-5p	PAR-CLIP	23446348
MIRT466458	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT466457	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT466456	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT466455	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT466454	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT466453	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT466452	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT466451	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT466450	hsa-miR-4796-3p	PAR-CLIP	23446348
MIRT466449	hsa-miR-3912-3p	PAR-CLIP	23446348
MIRT466448	hsa-miR-519a-3p	PAR-CLIP	23446348
MIRT466447	hsa-miR-519b-3p	PAR-CLIP	23446348
MIRT466446	hsa-miR-519c-3p	PAR-CLIP	23446348
MIRT466445	hsa-miR-101-5p	PAR-CLIP	23446348
MIRT466444	hsa-miR-142-5p	PAR-CLIP	23446348
MIRT466443	hsa-miR-5590-3p	PAR-CLIP	23446348
MIRT466441	hsa-miR-4679	PAR-CLIP	23446348
MIRT466440	hsa-miR-4424	PAR-CLIP	23446348
MIRT466439	hsa-miR-337-3p	PAR-CLIP	23446348
MIRT466437	hsa-miR-448	PAR-CLIP	23446348
MIRT466459	hsa-miR-3609	PAR-CLIP	23592263
MIRT466460	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT466458	hsa-miR-106a-5p	PAR-CLIP	23592263
MIRT466457	hsa-miR-106b-5p	PAR-CLIP	23592263
MIRT466456	hsa-miR-17-5p	PAR-CLIP	23592263
MIRT466455	hsa-miR-20a-5p	PAR-CLIP	23592263
MIRT466454	hsa-miR-20b-5p	PAR-CLIP	23592263
MIRT466453	hsa-miR-519d-3p	PAR-CLIP	23592263
MIRT466452	hsa-miR-526b-3p	PAR-CLIP	23592263
MIRT466451	hsa-miR-93-5p	PAR-CLIP	23592263
MIRT466450	hsa-miR-4796-3p	PAR-CLIP	23592263
MIRT466449	hsa-miR-3912-3p	PAR-CLIP	23592263
MIRT466448	hsa-miR-519a-3p	PAR-CLIP	23592263
MIRT466447	hsa-miR-519b-3p	PAR-CLIP	23592263
MIRT466446	hsa-miR-519c-3p	PAR-CLIP	23592263
MIRT466445	hsa-miR-101-5p	PAR-CLIP	23592263
MIRT466444	hsa-miR-142-5p	PAR-CLIP	23592263
MIRT466443	hsa-miR-5590-3p	PAR-CLIP	23592263
MIRT466442	hsa-miR-4677-3p	PAR-CLIP	23592263
MIRT466441	hsa-miR-4679	PAR-CLIP	23592263
MIRT466440	hsa-miR-4424	PAR-CLIP	23592263
MIRT466439	hsa-miR-337-3p	PAR-CLIP	23592263
MIRT466438	hsa-miR-203b-3p	PAR-CLIP	23592263
MIRT466437	hsa-miR-448	PAR-CLIP	23592263
MIRT731449	hsa-miR-199a-3p	Luciferase reporter assayWestern blot	28126676
MIRT731449	hsa-miR-199a-3p	Luciferase reporter assayWestern blot	28126676
MIRT732746	hsa-miR-376a-3p	qRT-PCR	31930701
MIRT733131	hsa-miR-181a-5p	RNA-seqqRT-PCR	33670365
MIRT733132	hsa-miR-181b-5p	RNA-seqqRT-PCR	33670365
MIRT466459	hsa-miR-3609	HITS-CLIP	21572407
MIRT466460	hsa-miR-548ah-5p	HITS-CLIP	21572407
MIRT466458	hsa-miR-106a-5p	HITS-CLIP	21572407
MIRT466457	hsa-miR-106b-5p	HITS-CLIP	21572407
MIRT466456	hsa-miR-17-5p	HITS-CLIP	21572407
MIRT466455	hsa-miR-20a-5p	HITS-CLIP	21572407
MIRT466454	hsa-miR-20b-5p	HITS-CLIP	21572407
MIRT466453	hsa-miR-519d-3p	HITS-CLIP	21572407
MIRT466452	hsa-miR-526b-3p	HITS-CLIP	21572407
MIRT466451	hsa-miR-93-5p	HITS-CLIP	21572407
MIRT466450	hsa-miR-4796-3p	HITS-CLIP	21572407
MIRT466449	hsa-miR-3912-3p	HITS-CLIP	21572407
MIRT466448	hsa-miR-519a-3p	HITS-CLIP	21572407
MIRT466447	hsa-miR-519b-3p	HITS-CLIP	21572407
MIRT466446	hsa-miR-519c-3p	HITS-CLIP	21572407
MIRT466445	hsa-miR-101-5p	HITS-CLIP	21572407
MIRT466444	hsa-miR-142-5p	HITS-CLIP	21572407
MIRT466443	hsa-miR-5590-3p	HITS-CLIP	21572407
MIRT466442	hsa-miR-4677-3p	HITS-CLIP	21572407
MIRT466441	hsa-miR-4679	HITS-CLIP	21572407
MIRT466440	hsa-miR-4424	HITS-CLIP	21572407
MIRT466439	hsa-miR-337-3p	HITS-CLIP	21572407
MIRT466437	hsa-miR-448	HITS-CLIP	21572407
MIRT630549	hsa-miR-8485	HITS-CLIP	23824327
MIRT652751	hsa-miR-6767-3p	HITS-CLIP	23824327
MIRT652750	hsa-miR-8064	HITS-CLIP	23824327
MIRT621851	hsa-miR-4432	HITS-CLIP	23824327
MIRT621850	hsa-miR-8087	HITS-CLIP	23824327
MIRT630549	hsa-miR-8485	HITS-CLIP	23824327
MIRT621849	hsa-miR-4719	HITS-CLIP	23824327
MIRT652751	hsa-miR-6767-3p	HITS-CLIP	23824327
MIRT652750	hsa-miR-8064	HITS-CLIP	23824327
MIRT621848	hsa-miR-499a-5p	HITS-CLIP	23824327
MIRT621849	hsa-miR-4719	HITS-CLIP	23824327
MIRT652751	hsa-miR-6767-3p	HITS-CLIP	23824327
MIRT652750	hsa-miR-8064	HITS-CLIP	23824327
MIRT621851	hsa-miR-4432	HITS-CLIP	23824327
MIRT621850	hsa-miR-8087	HITS-CLIP	23824327
MIRT630549	hsa-miR-8485	HITS-CLIP	23824327
MIRT621849	hsa-miR-4719	HITS-CLIP	23824327
MIRT621848	hsa-miR-499a-5p	HITS-CLIP	23824327
MIRT630548	hsa-miR-6083	HITS-CLIP	23824327
MIRT621851	hsa-miR-4432	HITS-CLIP	23824327
MIRT621850	hsa-miR-8087	HITS-CLIP	23824327
MIRT621849	hsa-miR-4719	HITS-CLIP	23824327
MIRT621848	hsa-miR-499a-5p	HITS-CLIP	23824327
MIRT466459	hsa-miR-3609	PAR-CLIP	20371350
MIRT466460	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT466458	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT466457	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT466456	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT466455	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT466454	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT466453	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT466452	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT466451	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT466450	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT466449	hsa-miR-3912-3p	PAR-CLIP	20371350
MIRT466448	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT466447	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT466446	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT466445	hsa-miR-101-5p	PAR-CLIP	20371350
MIRT466444	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT466443	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT466442	hsa-miR-4677-3p	PAR-CLIP	20371350
MIRT466441	hsa-miR-4679	PAR-CLIP	20371350
MIRT466440	hsa-miR-4424	PAR-CLIP	20371350
MIRT466439	hsa-miR-337-3p	PAR-CLIP	20371350
MIRT466437	hsa-miR-448	PAR-CLIP	20371350
MIRT526413	hsa-miR-6871-5p	PAR-CLIP	22012620
MIRT526412	hsa-miR-3690	PAR-CLIP	22012620
MIRT526411	hsa-miR-4254	PAR-CLIP	22012620
MIRT526410	hsa-miR-6128	PAR-CLIP	22012620
MIRT526409	hsa-miR-1-3p	PAR-CLIP	22012620
MIRT526408	hsa-miR-206	PAR-CLIP	22012620
MIRT526407	hsa-miR-613	PAR-CLIP	22012620
MIRT526406	hsa-miR-6878-5p	PAR-CLIP	22012620
MIRT526405	hsa-miR-6731-5p	PAR-CLIP	22012620
MIRT526404	hsa-miR-8085	PAR-CLIP	22012620
MIRT526403	hsa-miR-1343-3p	PAR-CLIP	22012620
MIRT526402	hsa-miR-6783-3p	PAR-CLIP	22012620
MIRT526401	hsa-miR-30c-1-3p	PAR-CLIP	22012620
MIRT526400	hsa-miR-30c-2-3p	PAR-CLIP	22012620
MIRT526399	hsa-miR-6788-5p	PAR-CLIP	22012620
MIRT526398	hsa-miR-2054	PAR-CLIP	22012620
MIRT466459	hsa-miR-3609	PAR-CLIP	23446348
MIRT466460	hsa-miR-548ah-5p	PAR-CLIP	23446348
MIRT466458	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT466457	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT466456	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT466455	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT466454	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT466453	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT466452	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT466451	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT466450	hsa-miR-4796-3p	PAR-CLIP	23446348
MIRT466449	hsa-miR-3912-3p	PAR-CLIP	23446348
MIRT466448	hsa-miR-519a-3p	PAR-CLIP	23446348
MIRT466447	hsa-miR-519b-3p	PAR-CLIP	23446348
MIRT466446	hsa-miR-519c-3p	PAR-CLIP	23446348
MIRT466445	hsa-miR-101-5p	PAR-CLIP	23446348
MIRT466444	hsa-miR-142-5p	PAR-CLIP	23446348
MIRT466443	hsa-miR-5590-3p	PAR-CLIP	23446348
MIRT466441	hsa-miR-4679	PAR-CLIP	23446348
MIRT466440	hsa-miR-4424	PAR-CLIP	23446348
MIRT466439	hsa-miR-337-3p	PAR-CLIP	23446348
MIRT466437	hsa-miR-448	PAR-CLIP	23446348
MIRT466459	hsa-miR-3609	PAR-CLIP	23592263
MIRT466460	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT466458	hsa-miR-106a-5p	PAR-CLIP	23592263
MIRT466457	hsa-miR-106b-5p	PAR-CLIP	23592263
MIRT466456	hsa-miR-17-5p	PAR-CLIP	23592263
MIRT466455	hsa-miR-20a-5p	PAR-CLIP	23592263
MIRT466454	hsa-miR-20b-5p	PAR-CLIP	23592263
MIRT466453	hsa-miR-519d-3p	PAR-CLIP	23592263
MIRT466452	hsa-miR-526b-3p	PAR-CLIP	23592263
MIRT466451	hsa-miR-93-5p	PAR-CLIP	23592263
MIRT466450	hsa-miR-4796-3p	PAR-CLIP	23592263
MIRT466449	hsa-miR-3912-3p	PAR-CLIP	23592263
MIRT466448	hsa-miR-519a-3p	PAR-CLIP	23592263
MIRT466447	hsa-miR-519b-3p	PAR-CLIP	23592263
MIRT466446	hsa-miR-519c-3p	PAR-CLIP	23592263
MIRT466445	hsa-miR-101-5p	PAR-CLIP	23592263
MIRT466444	hsa-miR-142-5p	PAR-CLIP	23592263
MIRT466443	hsa-miR-5590-3p	PAR-CLIP	23592263
MIRT466442	hsa-miR-4677-3p	PAR-CLIP	23592263
MIRT466441	hsa-miR-4679	PAR-CLIP	23592263
MIRT466440	hsa-miR-4424	PAR-CLIP	23592263
MIRT466439	hsa-miR-337-3p	PAR-CLIP	23592263
MIRT466438	hsa-miR-203b-3p	PAR-CLIP	23592263
MIRT466437	hsa-miR-448	PAR-CLIP	23592263
MIRT1419574	hsa-miR-1244	CLIP-seq
MIRT1419575	hsa-miR-1257	CLIP-seq
MIRT1419576	hsa-miR-1270	CLIP-seq
MIRT1419577	hsa-miR-1273e	CLIP-seq
MIRT1419578	hsa-miR-1914	CLIP-seq
MIRT1419579	hsa-miR-1972	CLIP-seq
MIRT1419580	hsa-miR-199b-3p	CLIP-seq
MIRT1419581	hsa-miR-23a	CLIP-seq
MIRT1419582	hsa-miR-23b	CLIP-seq
MIRT1419583	hsa-miR-23c	CLIP-seq
MIRT1419584	hsa-miR-298	CLIP-seq
MIRT1419585	hsa-miR-3074-5p	CLIP-seq
MIRT1419586	hsa-miR-3119	CLIP-seq
MIRT1419587	hsa-miR-3129-5p	CLIP-seq
MIRT1419588	hsa-miR-3144-3p	CLIP-seq
MIRT1419589	hsa-miR-3160-3p	CLIP-seq
MIRT1419590	hsa-miR-330-3p	CLIP-seq
MIRT1419591	hsa-miR-34b	CLIP-seq
MIRT1419592	hsa-miR-3611	CLIP-seq
MIRT1419593	hsa-miR-3662	CLIP-seq
MIRT1419594	hsa-miR-3664-5p	CLIP-seq
MIRT1419595	hsa-miR-3914	CLIP-seq
MIRT1419596	hsa-miR-3920	CLIP-seq
MIRT1419597	hsa-miR-4259	CLIP-seq
MIRT1419598	hsa-miR-4289	CLIP-seq
MIRT1419599	hsa-miR-4427	CLIP-seq
MIRT1419600	hsa-miR-4438	CLIP-seq
MIRT1419601	hsa-miR-4487	CLIP-seq
MIRT1419602	hsa-miR-4531	CLIP-seq
MIRT1419603	hsa-miR-4666-3p	CLIP-seq
MIRT1419604	hsa-miR-4680-3p	CLIP-seq
MIRT1419605	hsa-miR-4687-3p	CLIP-seq
MIRT1419606	hsa-miR-4705	CLIP-seq
MIRT1419607	hsa-miR-4714-5p	CLIP-seq
MIRT1419608	hsa-miR-4715-5p	CLIP-seq
MIRT1419609	hsa-miR-4724-3p	CLIP-seq
MIRT1419610	hsa-miR-4728-3p	CLIP-seq
MIRT1419611	hsa-miR-4797-3p	CLIP-seq
MIRT1419612	hsa-miR-491-3p	CLIP-seq
MIRT1419613	hsa-miR-518a-5p	CLIP-seq
MIRT1419614	hsa-miR-520g	CLIP-seq
MIRT1419615	hsa-miR-520h	CLIP-seq
MIRT1419616	hsa-miR-527	CLIP-seq
MIRT1419617	hsa-miR-548ag	CLIP-seq
MIRT1419618	hsa-miR-548ai	CLIP-seq
MIRT1419619	hsa-miR-548m	CLIP-seq
MIRT1419620	hsa-miR-550a	CLIP-seq
MIRT1419621	hsa-miR-556-5p	CLIP-seq
MIRT1419622	hsa-miR-558	CLIP-seq
MIRT1419623	hsa-miR-582-3p	CLIP-seq
MIRT1419624	hsa-miR-593	CLIP-seq
MIRT1419625	hsa-miR-607	CLIP-seq
MIRT1419626	hsa-miR-620	CLIP-seq
MIRT1419627	hsa-miR-626	CLIP-seq
MIRT1419628	hsa-miR-647	CLIP-seq
MIRT1419629	hsa-miR-875-5p	CLIP-seq
MIRT1419630	hsa-miR-936	CLIP-seq
MIRT1419575	hsa-miR-1257	CLIP-seq
MIRT2126079	hsa-miR-1283	CLIP-seq
MIRT2126080	hsa-miR-194	CLIP-seq
MIRT1419579	hsa-miR-1972	CLIP-seq
MIRT2126081	hsa-miR-3074-3p	CLIP-seq
MIRT2126082	hsa-miR-3126-3p	CLIP-seq
MIRT1419588	hsa-miR-3144-3p	CLIP-seq
MIRT2126083	hsa-miR-3163	CLIP-seq
MIRT1419595	hsa-miR-3914	CLIP-seq
MIRT1419599	hsa-miR-4427	CLIP-seq
MIRT2126084	hsa-miR-4461	CLIP-seq
MIRT1419603	hsa-miR-4666-3p	CLIP-seq
MIRT2126085	hsa-miR-4678	CLIP-seq
MIRT1419604	hsa-miR-4680-3p	CLIP-seq
MIRT1419607	hsa-miR-4714-5p	CLIP-seq
MIRT2126086	hsa-miR-4793-5p	CLIP-seq
MIRT2126087	hsa-miR-486-5p	CLIP-seq
MIRT2126088	hsa-miR-548ae	CLIP-seq
MIRT2126089	hsa-miR-548aj	CLIP-seq
MIRT2126090	hsa-miR-548am	CLIP-seq
MIRT2126091	hsa-miR-548x	CLIP-seq
MIRT2126092	hsa-miR-568	CLIP-seq
MIRT2126093	hsa-miR-587	CLIP-seq
MIRT2126094	hsa-miR-629	CLIP-seq
MIRT2126095	hsa-miR-640	CLIP-seq
MIRT1419629	hsa-miR-875-5p	CLIP-seq
MIRT1419574	hsa-miR-1244	CLIP-seq
MIRT1419575	hsa-miR-1257	CLIP-seq
MIRT1419577	hsa-miR-1273e	CLIP-seq
MIRT2126079	hsa-miR-1283	CLIP-seq
MIRT2126080	hsa-miR-194	CLIP-seq
MIRT2348060	hsa-miR-1976	CLIP-seq
MIRT1419580	hsa-miR-199b-3p	CLIP-seq
MIRT1419581	hsa-miR-23a	CLIP-seq
MIRT1419582	hsa-miR-23b	CLIP-seq
MIRT1419583	hsa-miR-23c	CLIP-seq
MIRT2126081	hsa-miR-3074-3p	CLIP-seq
MIRT1419586	hsa-miR-3119	CLIP-seq
MIRT2126082	hsa-miR-3126-3p	CLIP-seq
MIRT1419587	hsa-miR-3129-5p	CLIP-seq
MIRT1419588	hsa-miR-3144-3p	CLIP-seq
MIRT1419590	hsa-miR-330-3p	CLIP-seq
MIRT1419591	hsa-miR-34b	CLIP-seq
MIRT1419593	hsa-miR-3662	CLIP-seq
MIRT1419594	hsa-miR-3664-5p	CLIP-seq
MIRT2348061	hsa-miR-3671	CLIP-seq
MIRT2348062	hsa-miR-3672	CLIP-seq
MIRT1419598	hsa-miR-4289	CLIP-seq
MIRT1419599	hsa-miR-4427	CLIP-seq
MIRT1419600	hsa-miR-4438	CLIP-seq
MIRT2126084	hsa-miR-4461	CLIP-seq
MIRT1419603	hsa-miR-4666-3p	CLIP-seq
MIRT2126085	hsa-miR-4678	CLIP-seq
MIRT1419604	hsa-miR-4680-3p	CLIP-seq
MIRT1419606	hsa-miR-4705	CLIP-seq
MIRT1419607	hsa-miR-4714-5p	CLIP-seq
MIRT2348063	hsa-miR-4722-3p	CLIP-seq
MIRT1419610	hsa-miR-4728-3p	CLIP-seq
MIRT2348064	hsa-miR-4775	CLIP-seq
MIRT2126086	hsa-miR-4793-5p	CLIP-seq
MIRT1419611	hsa-miR-4797-3p	CLIP-seq
MIRT2126087	hsa-miR-486-5p	CLIP-seq
MIRT1419612	hsa-miR-491-3p	CLIP-seq
MIRT1419613	hsa-miR-518a-5p	CLIP-seq
MIRT1419614	hsa-miR-520g	CLIP-seq
MIRT1419615	hsa-miR-520h	CLIP-seq
MIRT1419616	hsa-miR-527	CLIP-seq
MIRT2348065	hsa-miR-548ad	CLIP-seq
MIRT2126092	hsa-miR-568	CLIP-seq
MIRT2348066	hsa-miR-570	CLIP-seq
MIRT2126093	hsa-miR-587	CLIP-seq
MIRT2348067	hsa-miR-590-3p	CLIP-seq
MIRT1419624	hsa-miR-593	CLIP-seq
MIRT2348068	hsa-miR-603	CLIP-seq
MIRT1419625	hsa-miR-607	CLIP-seq
MIRT1419627	hsa-miR-626	CLIP-seq
MIRT2126094	hsa-miR-629	CLIP-seq
MIRT1419629	hsa-miR-875-5p	CLIP-seq
MIRT1419630	hsa-miR-936	CLIP-seq
MIRT2126081	hsa-miR-3074-3p	CLIP-seq
MIRT2433805	hsa-miR-4727-5p	CLIP-seq
MIRT2433806	hsa-miR-4763-5p	CLIP-seq
MIRT2348068	hsa-miR-603	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
MYC	Unknown	15988031

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001018	Function	Mitochondrial promoter sequence-specific DNA binding	IDA	19304746
GO:0001018	Function	Mitochondrial promoter sequence-specific DNA binding	IEA
GO:0001223	Function	Transcription coactivator binding	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IDA	18063578
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005515	Function	Protein binding	IPI	12897151, 25416956, 29445193, 29568061, 32296183
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IDA	29445193
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	NAS	29149603
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006390	Process	Mitochondrial transcription	IEA
GO:0006390	Process	Mitochondrial transcription	IMP	22037171
GO:0006391	Process	Transcription initiation at mitochondrial promoter	IBA
GO:0006391	Process	Transcription initiation at mitochondrial promoter	IDA	20410300, 29149603
GO:0007584	Process	Response to nutrient	IEA
GO:0031072	Function	Heat shock protein binding	IEA
GO:0032991	Component	Protein-containing complex	IDA	29445193
GO:0033108	Process	Mitochondrial respiratory chain complex assembly	IEA
GO:0034246	Function	Mitochondrial transcription factor activity	IBA
GO:0034246	Function	Mitochondrial transcription factor activity	IMP	22037171
GO:0042645	Component	Mitochondrial nucleoid	IBA
GO:0042645	Component	Mitochondrial nucleoid	IDA	18063578, 23275553, 24703694
GO:0042645	Component	Mitochondrial nucleoid	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	29445193

MIM	HGNC	e!Ensembl
600438	11741	ENSG00000108064

Q00059

Protein name

Transcription factor A, mitochondrial (mtTFA) (Mitochondrial transcription factor 1) (MtTF1) (Transcription factor 6) (TCF-6) (Transcription factor 6-like 2)

Protein function

Binds to the mitochondrial light strand promoter and functions in mitochondrial transcription regulation (PubMed:29445193, PubMed:32183942). Component of the mitochondrial transcription initiation complex, composed at least of TFB2M, TFAM and PO

PDB

3FGH , 3TMM , 3TQ6 , 4NNU , 4NOD , 6ERP , 6ERQ , 6HB4 , 6HC3 , 7LBW , 7LBX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00505	HMG_box	50 → 118	HMG (high mobility group) box	Domain
PF09011	HMG_box_2	152 → 219	HMG-box domain	Domain

Sequence

MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRF
SKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQ
LTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQE
KLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRK
YGAEEC

Sequence length

246

Interactions

View interactions

	KEGG		Reactome
	Apelin signaling pathway Huntington disease		Mitochondrial transcription initiation Transcriptional activation of mitochondrial biogenesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Mitochondrial DNA depletion syndrome 15 (hepatocerebral type)	Likely pathogenic	rs757075712, rs544132101	RCV000256433 RCV003337864	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (24)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BOWEN'S DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEROID LIPOFUSCINOSIS, NEURONAL 1, INFANTILE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEROID LIPOFUSCINOSIS, NEURONAL, 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HUNTINGTON DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE NEURONAL CEROID LIPOFUSCINOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-INFANTILE NEURONAL CEROID LIPOFUSCINOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITOCHONDRIAL DNA DEPLETION SYNDROME 15	—	CTD, ClinVar, Disgenet, HPO CTD, ClinVar, Disgenet, HPO CTD, ClinVar, Disgenet, HPO CTD, ClinVar, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURONAL CEROID-LIPOFUSCINOSES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE, SECONDARY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Premature ovarian insufficiency	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SECONDARY PARKINSON DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENSORINEURAL HEARING LOSS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sensorineural hearing loss disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TFAM-related disorder	Benign; Conflicting classifications of pathogenicity; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (167)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	17192785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	30138574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	27732955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23645454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	25243473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	18830724, 31081111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22077634, 26881032	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	17192785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	17192785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	18430995, 20977898, 21799244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	17192785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	17192785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	22354563, 24666819, 28511992		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arteriosclerosis	Arteriosclerosis	BEFREE	26002865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	40035723	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	26002865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerotic Parkinsonism	Atherosclerotic Parkinsonism	CTD_human_DG	28595911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bowen's Disease		Pubtator	21514422	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bowen`s Disease	Bowen`s Disease	CTD_human_DG	21514422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	37098490	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	28440425, 29747444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22129993, 24684598, 28126676, 28639399, 29434836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23172368, 27746856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29856906, 30242167, 35163779, 36719981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	20232213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36601865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24367550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	25243473, 36229065	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25243473, 27231905, 35308143	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22098591, 25243473, 31547300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	11579427, 12013805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ceroid lipofuscinosis, neuronal 1, infantile	Neuronal ceroid lipofuscinosis	CTD_human_DG	21224254		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholestasis	Cholestasis	BEFREE	22306509, 31773435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis, Extrahepatic	Cholestasis	BEFREE	22306509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	24367550, 26893822, 31198067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic progressive external ophthalmoplegia	Progressive External Ophthalmoplegia	LHGDN	12921794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	26881032	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	31269437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	27878255, 30659235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	27732955	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21467167, 22266811, 27732955, 29277826, 30157478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21205083, 27732955, 30157478, 39210159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27878255	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	16043643, 21467167, 30353496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conjugated hyperbilirubinemia	Conjugated hyperbilirubinemia	BEFREE	27448789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conjugated hyperbilirubinemia	Conjugated hyperbilirubinemia	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29922448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	24184878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deoxyguanosine Kinase Deficiency	Deoxyguanosine Kinase Deficiency	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	25844556	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	11579427, 11733104, 12013805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	25437179	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11579427, 11733104, 12013805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28864016	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37679776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21281975, 23210442, 7533791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	12803480, 23291000	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	25869329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	20232213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythrocytosis Familial 2	Erythrocytosis	Pubtator	35760869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	23109849, 29447301, 36038893	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	17192785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	20890895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28440425, 29747444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	29747444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28440425, 29747444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24002170, 28440425, 29374989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	12428064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	36833361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	16043643, 18772530, 21467167, 30353496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	27590140		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	BEFREE	28433632, 31529536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	28433632	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	30745857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	25863249, 27223823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoalbuminemia	Hypoalbuminemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoalbuminemia	Hypoalbuminemia	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	27448789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	12930954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	27783701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	27783701	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31430762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	21162720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh syndrome	Pubtator	22390282	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	28958595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoplakia	Leukoplakia	BEFREE	26403317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	24184878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16364319, 29137431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure	Liver failure	BEFREE	27448789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24367550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20232213	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	12759347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22129993, 24684598, 28126676, 28639399, 29434836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24367550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22098591, 31547300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27843028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21453679, 21467167, 22098591, 24002170, 25108120, 25578105, 26403317, 27843028, 28440425, 30157478, 30659235, 30862036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	27878255, 30659235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	26646563	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30242167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	30242167, 33670365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MELAS Syndrome	MELAS Syndrome	BEFREE	21708074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	20202876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial cardiomyopathy	Mitochondrial Cardiomyopathy	BEFREE	17003040, 20566479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	11382203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	12428064, 12803480, 18332166, 22077634, 23152058, 25844556, 29747444, 31081111, 31930701, 33273525, 33731350, 35091324, 35163779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MITOCHONDRIAL DNA DEPLETION SYNDROME 15 (HEPATOCEREBRAL TYPE)	Cardiomyopathic Mitochondrial DNA Depletion Syndrome	UNIPROT_DG	27448789		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
MITOCHONDRIAL DNA DEPLETION SYNDROME 15 (HEPATOCEREBRAL TYPE)	Cardiomyopathic Mitochondrial DNA Depletion Syndrome	GENOMICS_ENGLAND_DG	27448789		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
MITOCHONDRIAL DNA DEPLETION SYNDROME 15 (HEPATOCEREBRAL TYPE)	Cardiomyopathic Mitochondrial DNA Depletion Syndrome	CTD_human_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mitochondrial Encephalomyopathies	Mitochondrial encephalomyopathy	BEFREE	11382203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Myopathies	Mitochondrial myopathy	BEFREE	17003040, 18945718, 8185589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	33308266	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	BEFREE	18772530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	16043643, 20863902, 22709542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	16043643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	11382203, 17003040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12964965, 21467167, 22129993, 25108120, 29137431, 30157478, 30659235, 30862036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29364506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	20890895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26820294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17397829, 25921605, 31356832, 31440209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	35748248	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	27779689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy Hereditary Leber	Leber hereditary optic neuropathy	Pubtator	22390282	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	BEFREE	21918550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	30816440	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22098591, 31547300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22098591, 36012230	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	25108120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	17537576, 18248889, 18980857, 19925850, 22361577, 23939409, 24184878, 24768991, 31065234, 31689514		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	19374590, 21205083, 22361577, 23939409, 24768991, 31930701, 33539026, 36674978	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	31689514	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease, Secondary Vascular	Parkinson Disease	CTD_human_DG	28595911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	30440089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal ventricular fibrillation	Paroxysmal ventricular fibrillation	Pubtator	38079076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	31307745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	24204994	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	29030253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	30745857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	21467167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	17192785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	24184878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27843028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36719981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	17459894, 26893822, 31198067, 34831227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	24367550	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	30226866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary Parkinson Disease	Parkinson disease	CTD_human_DG	28595911		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sepsis	Sepsis	Pubtator	33273525, 33494815	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	20727424, 31430762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	21514422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	36613786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28438434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28438434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	24367550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	27079936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	20890895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29259235, 35163779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Visceral myopathy familial external ophthalmoplegia	Visceral neuropathy	Pubtator	30310528, 36311265, 38040710	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TFAM (transcription factor A, mitochondrial)