TERF1 (telomeric repeat binding factor 1)

Gene

• Entrez ID: 7013
• Gene name: Telomeric repeat binding factor 1
• Gene symbol: TERF1
• Synonyms (NCBI Gene): PIN2, TRBF1, TRF, TRF1, hTRF1-AS, t-TRF1
• Chromosome: 8
• Chromosome location: 8q21.11
• Summary: This gene encodes a telomere specific protein which is a component of the telomere nucleoprotein complex. This protein is present at telomeres throughout the cell cycle and functions as an inhibitor of telomerase, acting in cis to limit the elongation of

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004234	hsa-miR-346	Microarray	16822819
MIRT051641	hsa-let-7e-5p	CLASH	23622248
MIRT714778	hsa-miR-508-5p	HITS-CLIP	19536157
MIRT714777	hsa-miR-3664-5p	HITS-CLIP	19536157
MIRT714776	hsa-miR-6849-3p	HITS-CLIP	19536157
MIRT714775	hsa-miR-939-3p	HITS-CLIP	19536157
MIRT714774	hsa-miR-766-3p	HITS-CLIP	19536157
MIRT714773	hsa-miR-1285-3p	HITS-CLIP	19536157
MIRT714772	hsa-miR-3187-5p	HITS-CLIP	19536157
MIRT714771	hsa-miR-5189-5p	HITS-CLIP	19536157
MIRT714770	hsa-miR-612	HITS-CLIP	19536157
MIRT714769	hsa-miR-6860	HITS-CLIP	19536157
MIRT714768	hsa-miR-3120-5p	HITS-CLIP	19536157
MIRT714767	hsa-miR-661	HITS-CLIP	19536157
MIRT714766	hsa-miR-196a-3p	HITS-CLIP	19536157
MIRT714765	hsa-miR-6512-3p	HITS-CLIP	19536157
MIRT714764	hsa-miR-6720-5p	HITS-CLIP	19536157
MIRT714763	hsa-miR-6888-3p	HITS-CLIP	19536157
MIRT614476	hsa-miR-6506-3p	HITS-CLIP	23824327
MIRT614476	hsa-miR-6506-3p	HITS-CLIP	23824327
MIRT614475	hsa-miR-6128	HITS-CLIP	23824327
MIRT614476	hsa-miR-6506-3p	HITS-CLIP	23824327
MIRT614475	hsa-miR-6128	HITS-CLIP	23824327
MIRT614476	hsa-miR-6506-3p	HITS-CLIP	23824327
MIRT614475	hsa-miR-6128	HITS-CLIP	23824327
MIRT614476	hsa-miR-6506-3p	HITS-CLIP	23824327
MIRT614475	hsa-miR-6128	HITS-CLIP	23824327
MIRT614476	hsa-miR-6506-3p	HITS-CLIP	23824327
MIRT614475	hsa-miR-6128	HITS-CLIP	23824327
MIRT614476	hsa-miR-6506-3p	HITS-CLIP	23824327
MIRT614475	hsa-miR-6128	HITS-CLIP	23824327
MIRT614476	hsa-miR-6506-3p	HITS-CLIP	23824327
MIRT614475	hsa-miR-6128	HITS-CLIP	23824327
MIRT614476	hsa-miR-6506-3p	HITS-CLIP	23824327
MIRT614475	hsa-miR-6128	HITS-CLIP	23824327
MIRT714778	hsa-miR-508-5p	HITS-CLIP	19536157
MIRT714777	hsa-miR-3664-5p	HITS-CLIP	19536157
MIRT714776	hsa-miR-6849-3p	HITS-CLIP	19536157
MIRT714775	hsa-miR-939-3p	HITS-CLIP	19536157
MIRT714774	hsa-miR-766-3p	HITS-CLIP	19536157
MIRT714773	hsa-miR-1285-3p	HITS-CLIP	19536157
MIRT714772	hsa-miR-3187-5p	HITS-CLIP	19536157
MIRT714771	hsa-miR-5189-5p	HITS-CLIP	19536157
MIRT714770	hsa-miR-612	HITS-CLIP	19536157
MIRT714769	hsa-miR-6860	HITS-CLIP	19536157
MIRT714768	hsa-miR-3120-5p	HITS-CLIP	19536157
MIRT714767	hsa-miR-661	HITS-CLIP	19536157
MIRT714766	hsa-miR-196a-3p	HITS-CLIP	19536157
MIRT714765	hsa-miR-6512-3p	HITS-CLIP	19536157
MIRT714764	hsa-miR-6720-5p	HITS-CLIP	19536157
MIRT714763	hsa-miR-6888-3p	HITS-CLIP	19536157
MIRT614476	hsa-miR-6506-3p	HITS-CLIP	23824327
MIRT614476	hsa-miR-6506-3p	HITS-CLIP	23824327
MIRT614475	hsa-miR-6128	HITS-CLIP	23824327
MIRT614476	hsa-miR-6506-3p	HITS-CLIP	23824327
MIRT614475	hsa-miR-6128	HITS-CLIP	23824327
MIRT614476	hsa-miR-6506-3p	HITS-CLIP	23824327
MIRT614475	hsa-miR-6128	HITS-CLIP	23824327
MIRT614476	hsa-miR-6506-3p	HITS-CLIP	23824327
MIRT614475	hsa-miR-6128	HITS-CLIP	23824327
MIRT614476	hsa-miR-6506-3p	HITS-CLIP	23824327
MIRT614475	hsa-miR-6128	HITS-CLIP	23824327
MIRT614476	hsa-miR-6506-3p	HITS-CLIP	23824327
MIRT614475	hsa-miR-6128	HITS-CLIP	23824327
MIRT614476	hsa-miR-6506-3p	HITS-CLIP	23824327
MIRT614475	hsa-miR-6128	HITS-CLIP	23824327
MIRT614476	hsa-miR-6506-3p	HITS-CLIP	23824327
MIRT614475	hsa-miR-6128	HITS-CLIP	23824327
MIRT1418214	hsa-miR-200b	CLIP-seq
MIRT1418215	hsa-miR-200c	CLIP-seq
MIRT1418216	hsa-miR-2355-3p	CLIP-seq
MIRT1418217	hsa-miR-3170	CLIP-seq
MIRT1418218	hsa-miR-4260	CLIP-seq
MIRT1418219	hsa-miR-4261	CLIP-seq
MIRT1418220	hsa-miR-429	CLIP-seq
MIRT1418221	hsa-miR-4318	CLIP-seq
MIRT1418222	hsa-miR-4464	CLIP-seq
MIRT1418223	hsa-miR-4496	CLIP-seq
MIRT1418224	hsa-miR-4643	CLIP-seq
MIRT1418225	hsa-miR-4646-3p	CLIP-seq
MIRT1418226	hsa-miR-4693-5p	CLIP-seq
MIRT1418227	hsa-miR-4717-3p	CLIP-seq
MIRT1418228	hsa-miR-4736	CLIP-seq
MIRT1418229	hsa-miR-4748	CLIP-seq
MIRT1418230	hsa-miR-496	CLIP-seq
MIRT1418231	hsa-miR-555	CLIP-seq
MIRT1418232	hsa-miR-657	CLIP-seq
MIRT1418233	hsa-miR-873	CLIP-seq
MIRT1418234	hsa-miR-892a	CLIP-seq
MIRT1418235	hsa-miR-196a	CLIP-seq
MIRT1418236	hsa-miR-196b	CLIP-seq
MIRT1418214	hsa-miR-200b	CLIP-seq
MIRT1418215	hsa-miR-200c	CLIP-seq
MIRT1418237	hsa-miR-2116	CLIP-seq
MIRT1418216	hsa-miR-2355-3p	CLIP-seq
MIRT1418238	hsa-miR-2355-5p	CLIP-seq
MIRT1418239	hsa-miR-296-3p	CLIP-seq
MIRT1418240	hsa-miR-3065-5p	CLIP-seq
MIRT1418241	hsa-miR-3174	CLIP-seq
MIRT1418242	hsa-miR-3192	CLIP-seq
MIRT1418243	hsa-miR-34b	CLIP-seq
MIRT1418244	hsa-miR-3614-5p	CLIP-seq
MIRT1418245	hsa-miR-3663-3p	CLIP-seq
MIRT1418246	hsa-miR-3664-3p	CLIP-seq
MIRT1418247	hsa-miR-374c	CLIP-seq
MIRT1418248	hsa-miR-3929	CLIP-seq
MIRT1418249	hsa-miR-425	CLIP-seq
MIRT1418220	hsa-miR-429	CLIP-seq
MIRT1418250	hsa-miR-4419b	CLIP-seq
MIRT1418251	hsa-miR-4421	CLIP-seq
MIRT1418252	hsa-miR-4433	CLIP-seq
MIRT1418253	hsa-miR-4459	CLIP-seq
MIRT1418254	hsa-miR-4478	CLIP-seq
MIRT1418255	hsa-miR-4503	CLIP-seq
MIRT1418225	hsa-miR-4646-3p	CLIP-seq
MIRT1418256	hsa-miR-4649-3p	CLIP-seq
MIRT1418257	hsa-miR-4666-5p	CLIP-seq
MIRT1418258	hsa-miR-4695-5p	CLIP-seq
MIRT1418259	hsa-miR-4698	CLIP-seq
MIRT1418260	hsa-miR-4722-5p	CLIP-seq
MIRT1418261	hsa-miR-4724-5p	CLIP-seq
MIRT1418262	hsa-miR-4726-3p	CLIP-seq
MIRT1418263	hsa-miR-4731-3p	CLIP-seq
MIRT1418264	hsa-miR-4738-3p	CLIP-seq
MIRT1418265	hsa-miR-4766-5p	CLIP-seq
MIRT1418266	hsa-miR-4768-3p	CLIP-seq
MIRT1418267	hsa-miR-4801	CLIP-seq
MIRT1418268	hsa-miR-485-5p	CLIP-seq
MIRT1418269	hsa-miR-499-3p	CLIP-seq
MIRT1418270	hsa-miR-499a-3p	CLIP-seq
MIRT1418271	hsa-miR-510	CLIP-seq
MIRT1418272	hsa-miR-512-5p	CLIP-seq
MIRT1418273	hsa-miR-548l	CLIP-seq
MIRT1418274	hsa-miR-548n	CLIP-seq
MIRT1418275	hsa-miR-548p	CLIP-seq
MIRT1418231	hsa-miR-555	CLIP-seq
MIRT1418276	hsa-miR-606	CLIP-seq
MIRT1418277	hsa-miR-607	CLIP-seq
MIRT1418278	hsa-miR-642b	CLIP-seq
MIRT1418279	hsa-miR-655	CLIP-seq
MIRT1418280	hsa-miR-921	CLIP-seq
MIRT1418281	hsa-miR-940	CLIP-seq
MIRT1418242	hsa-miR-3192	CLIP-seq
MIRT1418243	hsa-miR-34b	CLIP-seq
MIRT1418244	hsa-miR-3614-5p	CLIP-seq
MIRT1418266	hsa-miR-4768-3p	CLIP-seq
MIRT2125455	hsa-miR-1245	CLIP-seq
MIRT1418242	hsa-miR-3192	CLIP-seq
MIRT1418243	hsa-miR-34b	CLIP-seq
MIRT1418244	hsa-miR-3614-5p	CLIP-seq
MIRT2125456	hsa-miR-3662	CLIP-seq
MIRT1418246	hsa-miR-3664-3p	CLIP-seq
MIRT2125457	hsa-miR-376a	CLIP-seq
MIRT2125458	hsa-miR-376b	CLIP-seq
MIRT2125459	hsa-miR-3913-3p	CLIP-seq
MIRT1418248	hsa-miR-3929	CLIP-seq
MIRT1418250	hsa-miR-4419b	CLIP-seq
MIRT1418252	hsa-miR-4433	CLIP-seq
MIRT1418253	hsa-miR-4459	CLIP-seq
MIRT1418254	hsa-miR-4478	CLIP-seq
MIRT1418256	hsa-miR-4649-3p	CLIP-seq
MIRT1418258	hsa-miR-4695-5p	CLIP-seq
MIRT1418259	hsa-miR-4698	CLIP-seq
MIRT1418260	hsa-miR-4722-5p	CLIP-seq
MIRT1418266	hsa-miR-4768-3p	CLIP-seq
MIRT2125460	hsa-miR-4775	CLIP-seq
MIRT1418268	hsa-miR-485-5p	CLIP-seq
MIRT2125461	hsa-miR-487a	CLIP-seq
MIRT1418271	hsa-miR-510	CLIP-seq
MIRT1418272	hsa-miR-512-5p	CLIP-seq
MIRT2125462	hsa-miR-590-3p	CLIP-seq
MIRT1418281	hsa-miR-940	CLIP-seq
MIRT2347806	hsa-miR-1293	CLIP-seq
MIRT2347807	hsa-miR-216a	CLIP-seq
MIRT2347808	hsa-miR-216b	CLIP-seq
MIRT2347809	hsa-miR-3065-3p	CLIP-seq
MIRT2347810	hsa-miR-3122	CLIP-seq
MIRT2347811	hsa-miR-3165	CLIP-seq
MIRT1418242	hsa-miR-3192	CLIP-seq
MIRT1418243	hsa-miR-34b	CLIP-seq
MIRT2347812	hsa-miR-3607-3p	CLIP-seq
MIRT1418244	hsa-miR-3614-5p	CLIP-seq
MIRT1418246	hsa-miR-3664-3p	CLIP-seq
MIRT2347813	hsa-miR-3686	CLIP-seq
MIRT2347814	hsa-miR-3913-5p	CLIP-seq
MIRT1418248	hsa-miR-3929	CLIP-seq
MIRT2347815	hsa-miR-4252	CLIP-seq
MIRT1418250	hsa-miR-4419b	CLIP-seq
MIRT1418252	hsa-miR-4433	CLIP-seq
MIRT1418253	hsa-miR-4459	CLIP-seq
MIRT1418254	hsa-miR-4478	CLIP-seq
MIRT2347816	hsa-miR-4483	CLIP-seq
MIRT1418256	hsa-miR-4649-3p	CLIP-seq
MIRT1418258	hsa-miR-4695-5p	CLIP-seq
MIRT1418260	hsa-miR-4722-5p	CLIP-seq
MIRT1418266	hsa-miR-4768-3p	CLIP-seq
MIRT1418268	hsa-miR-485-5p	CLIP-seq
MIRT1418271	hsa-miR-510	CLIP-seq
MIRT1418281	hsa-miR-940	CLIP-seq
MIRT2395665	hsa-miR-1285	CLIP-seq
MIRT2347815	hsa-miR-4252	CLIP-seq
MIRT2395666	hsa-miR-4793-3p	CLIP-seq
MIRT2395667	hsa-miR-766	CLIP-seq
MIRT2461310	hsa-miR-1268	CLIP-seq
MIRT2461311	hsa-miR-1268b	CLIP-seq
MIRT2347807	hsa-miR-216a	CLIP-seq
MIRT2347808	hsa-miR-216b	CLIP-seq
MIRT2347809	hsa-miR-3065-3p	CLIP-seq
MIRT2347810	hsa-miR-3122	CLIP-seq
MIRT1418242	hsa-miR-3192	CLIP-seq
MIRT1418243	hsa-miR-34b	CLIP-seq
MIRT2347812	hsa-miR-3607-3p	CLIP-seq
MIRT1418244	hsa-miR-3614-5p	CLIP-seq
MIRT1418246	hsa-miR-3664-3p	CLIP-seq
MIRT2347813	hsa-miR-3686	CLIP-seq
MIRT2347814	hsa-miR-3913-5p	CLIP-seq
MIRT1418248	hsa-miR-3929	CLIP-seq
MIRT1418250	hsa-miR-4419b	CLIP-seq
MIRT1418252	hsa-miR-4433	CLIP-seq
MIRT1418253	hsa-miR-4459	CLIP-seq
MIRT1418254	hsa-miR-4478	CLIP-seq
MIRT2461312	hsa-miR-4486	CLIP-seq
MIRT1418256	hsa-miR-4649-3p	CLIP-seq
MIRT1418258	hsa-miR-4695-5p	CLIP-seq
MIRT1418260	hsa-miR-4722-5p	CLIP-seq
MIRT1418266	hsa-miR-4768-3p	CLIP-seq
MIRT1418268	hsa-miR-485-5p	CLIP-seq
MIRT1418271	hsa-miR-510	CLIP-seq
MIRT1418272	hsa-miR-512-5p	CLIP-seq
MIRT2461313	hsa-miR-548c-3p	CLIP-seq
MIRT2461314	hsa-miR-585	CLIP-seq
MIRT1418281	hsa-miR-940	CLIP-seq
MIRT2347806	hsa-miR-1293	CLIP-seq
MIRT2347807	hsa-miR-216a	CLIP-seq
MIRT2347808	hsa-miR-216b	CLIP-seq
MIRT2347809	hsa-miR-3065-3p	CLIP-seq
MIRT2347810	hsa-miR-3122	CLIP-seq
MIRT2347812	hsa-miR-3607-3p	CLIP-seq
MIRT2347813	hsa-miR-3686	CLIP-seq
MIRT2347814	hsa-miR-3913-5p	CLIP-seq
MIRT2347816	hsa-miR-4483	CLIP-seq
MIRT2461312	hsa-miR-4486	CLIP-seq
MIRT2461313	hsa-miR-548c-3p	CLIP-seq
MIRT2125455	hsa-miR-1245	CLIP-seq
MIRT2461310	hsa-miR-1268	CLIP-seq
MIRT2461311	hsa-miR-1268b	CLIP-seq
MIRT2395665	hsa-miR-1285	CLIP-seq
MIRT2347806	hsa-miR-1293	CLIP-seq
MIRT2640632	hsa-miR-154	CLIP-seq
MIRT1418235	hsa-miR-196a	CLIP-seq
MIRT1418236	hsa-miR-196b	CLIP-seq
MIRT2640633	hsa-miR-199a-5p	CLIP-seq
MIRT2640634	hsa-miR-199b-5p	CLIP-seq
MIRT2347807	hsa-miR-216a	CLIP-seq
MIRT2347808	hsa-miR-216b	CLIP-seq
MIRT1418238	hsa-miR-2355-5p	CLIP-seq
MIRT2347809	hsa-miR-3065-3p	CLIP-seq
MIRT2347810	hsa-miR-3122	CLIP-seq
MIRT2640635	hsa-miR-3162-3p	CLIP-seq
MIRT2347811	hsa-miR-3165	CLIP-seq
MIRT1418241	hsa-miR-3174	CLIP-seq
MIRT1418242	hsa-miR-3192	CLIP-seq
MIRT2640636	hsa-miR-323-5p	CLIP-seq
MIRT1418243	hsa-miR-34b	CLIP-seq
MIRT2347812	hsa-miR-3607-3p	CLIP-seq
MIRT1418244	hsa-miR-3614-5p	CLIP-seq
MIRT2640637	hsa-miR-3650	CLIP-seq
MIRT1418245	hsa-miR-3663-3p	CLIP-seq
MIRT1418246	hsa-miR-3664-3p	CLIP-seq
MIRT2347813	hsa-miR-3686	CLIP-seq
MIRT2347814	hsa-miR-3913-5p	CLIP-seq
MIRT1418248	hsa-miR-3929	CLIP-seq
MIRT2640638	hsa-miR-3938	CLIP-seq
MIRT2347815	hsa-miR-4252	CLIP-seq
MIRT2640639	hsa-miR-4286	CLIP-seq
MIRT1418250	hsa-miR-4419b	CLIP-seq
MIRT1418252	hsa-miR-4433	CLIP-seq
MIRT1418253	hsa-miR-4459	CLIP-seq
MIRT1418254	hsa-miR-4478	CLIP-seq
MIRT2347816	hsa-miR-4483	CLIP-seq
MIRT2461312	hsa-miR-4486	CLIP-seq
MIRT1418256	hsa-miR-4649-3p	CLIP-seq
MIRT1418258	hsa-miR-4695-5p	CLIP-seq
MIRT1418259	hsa-miR-4698	CLIP-seq
MIRT2640640	hsa-miR-4714-5p	CLIP-seq
MIRT1418260	hsa-miR-4722-5p	CLIP-seq
MIRT1418262	hsa-miR-4726-3p	CLIP-seq
MIRT2640641	hsa-miR-4729	CLIP-seq
MIRT1418263	hsa-miR-4731-3p	CLIP-seq
MIRT1418266	hsa-miR-4768-3p	CLIP-seq
MIRT2395666	hsa-miR-4793-3p	CLIP-seq
MIRT2640642	hsa-miR-4795-3p	CLIP-seq
MIRT2640643	hsa-miR-4796-5p	CLIP-seq
MIRT1418267	hsa-miR-4801	CLIP-seq
MIRT1418268	hsa-miR-485-5p	CLIP-seq
MIRT1418271	hsa-miR-510	CLIP-seq
MIRT1418272	hsa-miR-512-5p	CLIP-seq
MIRT2461313	hsa-miR-548c-3p	CLIP-seq
MIRT1418273	hsa-miR-548l	CLIP-seq
MIRT1418274	hsa-miR-548n	CLIP-seq
MIRT1418275	hsa-miR-548p	CLIP-seq
MIRT2640644	hsa-miR-550a	CLIP-seq
MIRT2461314	hsa-miR-585	CLIP-seq
MIRT1418277	hsa-miR-607	CLIP-seq
MIRT1418278	hsa-miR-642b	CLIP-seq
MIRT2395667	hsa-miR-766	CLIP-seq
MIRT2640645	hsa-miR-876-3p	CLIP-seq
MIRT1418280	hsa-miR-921	CLIP-seq
MIRT1418281	hsa-miR-940	CLIP-seq
MIRT2125455	hsa-miR-1245	CLIP-seq
MIRT2461310	hsa-miR-1268	CLIP-seq
MIRT2461311	hsa-miR-1268b	CLIP-seq
MIRT2395665	hsa-miR-1285	CLIP-seq
MIRT2347806	hsa-miR-1293	CLIP-seq
MIRT1418235	hsa-miR-196a	CLIP-seq
MIRT1418236	hsa-miR-196b	CLIP-seq
MIRT2347807	hsa-miR-216a	CLIP-seq
MIRT2347808	hsa-miR-216b	CLIP-seq
MIRT1418238	hsa-miR-2355-5p	CLIP-seq
MIRT2347809	hsa-miR-3065-3p	CLIP-seq
MIRT2347810	hsa-miR-3122	CLIP-seq
MIRT2347811	hsa-miR-3165	CLIP-seq
MIRT1418241	hsa-miR-3174	CLIP-seq
MIRT1418242	hsa-miR-3192	CLIP-seq
MIRT2640636	hsa-miR-323-5p	CLIP-seq
MIRT1418243	hsa-miR-34b	CLIP-seq
MIRT2347812	hsa-miR-3607-3p	CLIP-seq
MIRT1418244	hsa-miR-3614-5p	CLIP-seq
MIRT2640637	hsa-miR-3650	CLIP-seq
MIRT1418245	hsa-miR-3663-3p	CLIP-seq
MIRT1418246	hsa-miR-3664-3p	CLIP-seq
MIRT2347813	hsa-miR-3686	CLIP-seq
MIRT2347814	hsa-miR-3913-5p	CLIP-seq
MIRT1418248	hsa-miR-3929	CLIP-seq
MIRT2347815	hsa-miR-4252	CLIP-seq
MIRT1418250	hsa-miR-4419b	CLIP-seq
MIRT1418252	hsa-miR-4433	CLIP-seq
MIRT1418253	hsa-miR-4459	CLIP-seq
MIRT1418254	hsa-miR-4478	CLIP-seq
MIRT2347816	hsa-miR-4483	CLIP-seq
MIRT2461312	hsa-miR-4486	CLIP-seq
MIRT1418256	hsa-miR-4649-3p	CLIP-seq
MIRT1418258	hsa-miR-4695-5p	CLIP-seq
MIRT1418259	hsa-miR-4698	CLIP-seq
MIRT1418260	hsa-miR-4722-5p	CLIP-seq
MIRT1418262	hsa-miR-4726-3p	CLIP-seq
MIRT1418263	hsa-miR-4731-3p	CLIP-seq
MIRT1418266	hsa-miR-4768-3p	CLIP-seq
MIRT2395666	hsa-miR-4793-3p	CLIP-seq
MIRT1418267	hsa-miR-4801	CLIP-seq
MIRT1418268	hsa-miR-485-5p	CLIP-seq
MIRT1418271	hsa-miR-510	CLIP-seq
MIRT1418272	hsa-miR-512-5p	CLIP-seq
MIRT2461313	hsa-miR-548c-3p	CLIP-seq
MIRT2640644	hsa-miR-550a	CLIP-seq
MIRT2461314	hsa-miR-585	CLIP-seq
MIRT1418277	hsa-miR-607	CLIP-seq
MIRT1418278	hsa-miR-642b	CLIP-seq
MIRT2395667	hsa-miR-766	CLIP-seq
MIRT2640645	hsa-miR-876-3p	CLIP-seq
MIRT1418280	hsa-miR-921	CLIP-seq
MIRT1418281	hsa-miR-940	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATM	Repression	17694070

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000723	Process	Telomere maintenance	IEA
GO:0000723	Process	Telomere maintenance	IMP	24415760
GO:0000781	Component	Chromosome, telomeric region	HDA	19135898
GO:0000781	Component	Chromosome, telomeric region	IDA	9034193, 9391075, 11313893, 15133513, 15380063, 19487455, 21119197, 23685356, 24270157, 24415760
GO:0000781	Component	Chromosome, telomeric region	IEA
GO:0000783	Component	Nuclear telomere cap complex	IBA
GO:0000783	Component	Nuclear telomere cap complex	IDA	16880378
GO:0000783	Component	Nuclear telomere cap complex	IEA
GO:0000783	Component	Nuclear telomere cap complex	ISS	7502076
GO:0001650	Component	Fibrillar center	IDA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	NAS	7502076
GO:0003691	Function	Double-stranded telomeric DNA binding	IBA
GO:0003691	Function	Double-stranded telomeric DNA binding	IDA	1406665, 12768206, 12782650, 15608617, 21852327
GO:0003720	Function	Telomerase activity	IBA
GO:0003720	Function	Telomerase activity	IDA	23685356
GO:0005515	Function	Protein binding	IPI	9391075, 9822378, 11375976, 11701125, 11943150, 12080061, 12768206, 15133513, 15181449, 15229185, 15314656, 15383534, 16169070, 16275645, 16880378, 17389648, 17589526, 17962804, 18202258, 19265708, 19487455, 20159592, 20181953, 20696165, 21044950, 21119197, 22039056, 22046132, 22153
GO:0005634	Component	Nucleus	IDA	1406665, 9391075, 11313893, 11854288
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	7502076
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA	11701125, 17389648, 19265708, 21119197, 24415760
GO:0005737	Component	Cytoplasm	IEA
GO:0005819	Component	Spindle	IDA	11943150
GO:0005819	Component	Spindle	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0007004	Process	Telomere maintenance via telomerase	IBA
GO:0007004	Process	Telomere maintenance via telomerase	IDA	23685356
GO:0007004	Process	Telomere maintenance via telomerase	IMP	9034193
GO:0008017	Function	Microtubule binding	IDA	11943150
GO:0008156	Process	Negative regulation of DNA replication	IDA	11327863
GO:0008301	Function	DNA binding, bending	IDA	9130722
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0016233	Process	Telomere capping	IDA	21852327
GO:0016604	Component	Nuclear body	IDA
GO:0032206	Process	Positive regulation of telomere maintenance	NAS	15383534
GO:0032211	Process	Negative regulation of telomere maintenance via telomerase	IEA
GO:0032211	Process	Negative regulation of telomere maintenance via telomerase	IGI	11971978
GO:0032211	Process	Negative regulation of telomere maintenance via telomerase	TAS	16275645, 24389012
GO:0032214	Process	Negative regulation of telomere maintenance via semi-conservative replication	NAS	15007108
GO:0042162	Function	Telomeric DNA binding	IDA	9034193, 9391075, 19265708, 19487455, 19854130, 23685356, 24415760
GO:0042162	Function	Telomeric DNA binding	IEA
GO:0042802	Function	Identical protein binding	IPI	9391075, 19487455
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	9130722, 15608617
GO:0045141	Process	Meiotic telomere clustering	IEA
GO:0051301	Process	Cell division	IEA
GO:0061820	Process	Telomeric D-loop disassembly	IEA
GO:0061820	Process	Telomeric D-loop disassembly	IGI	22039056
GO:0070187	Component	Shelterin complex	IDA	15383534, 21852327, 23685356
GO:0070187	Component	Shelterin complex	IEA
GO:0070187	Component	Shelterin complex	IPI	15383534
GO:0070187	Component	Shelterin complex	TAS	18202258
GO:0071532	Function	Ankyrin repeat binding	IPI	11854288
GO:0090656	Process	T-circle formation	TAS	27918544
GO:0098505	Function	G-rich strand telomeric DNA binding	IDA	17694070
GO:0098505	Function	G-rich strand telomeric DNA binding	IEA
GO:1904357	Process	Negative regulation of telomere maintenance via telomere lengthening	TAS	11854288
GO:1904792	Process	Positive regulation of shelterin complex assembly	IMP	24270157
GO:1904850	Process	Negative regulation of establishment of protein localization to telomere	IMP	25589350
GO:1904911	Process	Negative regulation of establishment of RNA localization to telomere	IMP	26586433
GO:1904914	Process	Negative regulation of establishment of protein-containing complex localization to telomere	IC	26586433
GO:1905839	Process	Negative regulation of telomeric D-loop disassembly	IBA
GO:1905839	Process	Negative regulation of telomeric D-loop disassembly	IDA	15200954
GO:1905839	Process	Negative regulation of telomeric D-loop disassembly	IEA

Other IDs

• MIM: 600951
• HGNC: 11728
• e!Ensembl: ENSG00000147601

Protein

• UniProt ID: P54274
• Protein name: Telomeric repeat-binding factor 1 (NIMA-interacting protein 2) (TTAGGG repeat-binding factor 1) (Telomeric protein Pin2/TRF1)
• Protein function: Binds the telomeric double-stranded 5'-TTAGGG-3' repeat and negatively regulates telomere length. Involved in the regulation of the mitotic spindle. Component of the shelterin complex (telosome) that is involved in the regulation of telomere len
• PDB: 1BA5, 1H6O, 1ITY, 1IV6, 1W0T, 3BQO, 3L82, 5HKP, 5WIR, 5XUP, 8F0A, 8F0U, 8F1T, 8F1U, 8F21, 8F26, 8OX1, 8W8G
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08558	TRF	74 → 270	Telomere repeat binding factor (TRF)	Domain
  PF00249	Myb_DNA-binding	380 → 428	Myb-like DNA-binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed and ubiquitous. Isoform Pin2 predominates.
• Sequence:

  MAEDVSSAAPSPRGCADGRDADPTEEQMAETERNDEEQFECQELLECQVQVGAPEEEEEE
  EEDAGLVAEAEAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNSAEAIIHGLSSLTACQL
  RTIYICQFLTRIAAGKTLDAQFENDERITPLESALMIWGSIEKEHDKLHEEIQNLIKIQA
  IAVCMENGNFKEAEEVFERIFGDPNSHMPFKSKLLMIISQKDTFHSFFQHFSYNHMMEKI
  KSYVNYVLSEKSSTFLMKAAAKVVESKRTRTITSQDKPSGNDVEMETEANLDTRKSVSDK
  QSAVTESSEGTVSLLRSHKNLFLSKLQHGTQQQDLNKKERRVGTPQSTKKKKESRRATES
  RIPVSKSQPVTPEKHRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVML
  KDRWRTMKKLKLISSDSED

• Sequence length: 439

Pathways

Reactome:

Recognition and association of DNA glycosylase with site containing an affected purine
Cleavage of the damaged purine
Packaging Of Telomere Ends
Telomere Extension By Telomerase
DNA Damage/Telomere Stress Induced Senescence

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TERF1-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	11123427, 11179492		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	11179492		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11179492		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	16786598		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	LHGDN	16786598		★☆☆☆☆ Found in Text Mining only
Alternating hemiplegia of childhood	Alternating hemiplegia of childhood	Pubtator	23708666	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	28162998		★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	16647572	Associate	★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	16647572		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	40035723	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	23691191	Inhibit	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	11744712, 11943150		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	11744712, 11943150	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	26799787, 31165277		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29343961		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	29343961		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	17301820		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	15792519		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	LHGDN	15792519		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	23691191	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23342266, 24091727, 24876105		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23342266, 24091727, 28424414	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18641004, 23570868	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11494028, 12007281		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19129217, 27221889	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16353195, 31273934		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25730259	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36982573	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	18022214		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	11179492		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	31404908		★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	24091727	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17301820, 31723042		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne syndrome	Pubtator	22904069	Associate	★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type II	Cockayne Syndrome	BEFREE	22904069		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16388518, 28417530		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16388518, 23268632, 28417530, 29870526, 32586834, 35035608	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25730259		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30761946		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30761946		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30761946		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29142423		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	27425647		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27425647		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	21665207, 29079528	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17666463, 21665207, 28236320		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28236320		★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis Congenita	BEFREE	21477109, 22932806, 27135879, 29581185		★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis congenita	Pubtator	29581185	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	23013791		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	35281615	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	9673357		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	9673357		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	16437597	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23691191	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29136505, 31273934		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29136505, 31273934		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	15792519		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	29079528	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	33495152	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	16421973		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	31723042		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11123427, 16421973	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11179492		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	16786598		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15632001, 18449889		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	33495152	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17020976, 18397896		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	34867955	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28808664	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	29130457		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	36497103	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23342266, 24091727, 24876105		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	9673357		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16353195, 31273934		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28808664		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	21116649		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12530079, 22151982, 26598640		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11123427, 12148588, 16353195, 23691191, 24268029, 25392422, 27425647, 28978030		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11313893, 23342266, 28424414		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21116649, 25457634, 25892537		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21116649, 25892537	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	27425647		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	20644899		★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	30896793	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	20644899		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	20644899	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	20137830		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	20137830		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	28404540	Inhibit	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	9118038		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11313893, 11494028, 11927006, 12943625, 15792519, 16353195, 16388518, 16437597, 17020976, 17301820, 18720522, 24268029, 26211574, 28162998, 29136505, 30079348, 31254127		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	24038938		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	25972604	Associate	★☆☆☆☆ Found in Text Mining only
Nicolaides Baraitser syndrome	Nicolaides Baraitser Syndrome	BEFREE	11448772		★☆☆☆☆ Found in Text Mining only
Nijmegen Breakage Syndrome	Nijmegen Breakage Syndrome	BEFREE	11448772		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16353195, 17681636, 19746267		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30268887, 31639326		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	30268887	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37880787	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	15949576		★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	22932806		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28808664		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	8958309		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28808664	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33174061	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25730259		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	18000138		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	33495152	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23912465		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32576588, 32606142	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12530079, 22151982, 26598640		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12530079		★☆☆☆☆ Found in Text Mining only
Telomeric 22q13 Monosomy Syndrome	22q13 monosomy syndrome	Pubtator	33495152	Associate	★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner syndrome	Pubtator	15200954	Associate	★☆☆☆☆ Found in Text Mining only