Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	6998
Gene name	Cripto, EGF-CFC family member 3
Gene symbol	CRIPTO3
Synonyms (NCBI Gene)	CR-3CRIPTOCRIPTO-3TDGF1P3TDGF2TDGF3
Chromosome	X
Chromosome location	Xq23

Show/Hide all (64)

miRTarBase ID	miRNA	Experiments	Reference
MIRT531035	hsa-miR-4436b-3p	PAR-CLIP	22012620
MIRT531034	hsa-miR-4632-5p	PAR-CLIP	22012620
MIRT531033	hsa-miR-6735-5p	PAR-CLIP	22012620
MIRT531032	hsa-miR-6879-5p	PAR-CLIP	22012620
MIRT531031	hsa-miR-7843-5p	PAR-CLIP	22012620
MIRT531030	hsa-miR-1244	PAR-CLIP	22012620
MIRT531029	hsa-miR-3616-3p	PAR-CLIP	22012620
MIRT531028	hsa-miR-6132	PAR-CLIP	22012620
MIRT531027	hsa-miR-6836-5p	PAR-CLIP	22012620
MIRT531026	hsa-miR-1207-5p	PAR-CLIP	22012620
MIRT531025	hsa-miR-4763-3p	PAR-CLIP	22012620
MIRT531024	hsa-miR-6878-5p	PAR-CLIP	22012620
MIRT531023	hsa-miR-6731-5p	PAR-CLIP	22012620
MIRT531022	hsa-miR-8085	PAR-CLIP	22012620
MIRT531021	hsa-miR-6721-5p	PAR-CLIP	22012620
MIRT531020	hsa-miR-30c-1-3p	PAR-CLIP	22012620
MIRT531019	hsa-miR-30c-2-3p	PAR-CLIP	22012620
MIRT531018	hsa-miR-6788-5p	PAR-CLIP	22012620
MIRT531017	hsa-miR-1273h-5p	PAR-CLIP	22012620
MIRT531016	hsa-miR-30b-3p	PAR-CLIP	22012620
MIRT531015	hsa-miR-3689a-3p	PAR-CLIP	22012620
MIRT531014	hsa-miR-3689b-3p	PAR-CLIP	22012620
MIRT531013	hsa-miR-3689c	PAR-CLIP	22012620
MIRT531012	hsa-miR-6779-5p	PAR-CLIP	22012620
MIRT531011	hsa-miR-6780a-5p	PAR-CLIP	22012620
MIRT531010	hsa-miR-510-3p	PAR-CLIP	22012620
MIRT531009	hsa-miR-450a-1-3p	PAR-CLIP	22012620
MIRT531008	hsa-miR-3122	PAR-CLIP	22012620
MIRT531007	hsa-miR-3913-5p	PAR-CLIP	22012620
MIRT531006	hsa-miR-887-5p	PAR-CLIP	22012620
MIRT531005	hsa-miR-6513-5p	PAR-CLIP	22012620
MIRT531004	hsa-miR-129-5p	PAR-CLIP	22012620
MIRT531035	hsa-miR-4436b-3p	PAR-CLIP	22012620
MIRT531034	hsa-miR-4632-5p	PAR-CLIP	22012620
MIRT531033	hsa-miR-6735-5p	PAR-CLIP	22012620
MIRT531032	hsa-miR-6879-5p	PAR-CLIP	22012620
MIRT531031	hsa-miR-7843-5p	PAR-CLIP	22012620
MIRT531030	hsa-miR-1244	PAR-CLIP	22012620
MIRT531029	hsa-miR-3616-3p	PAR-CLIP	22012620
MIRT531028	hsa-miR-6132	PAR-CLIP	22012620
MIRT531027	hsa-miR-6836-5p	PAR-CLIP	22012620
MIRT531026	hsa-miR-1207-5p	PAR-CLIP	22012620
MIRT531025	hsa-miR-4763-3p	PAR-CLIP	22012620
MIRT531024	hsa-miR-6878-5p	PAR-CLIP	22012620
MIRT531023	hsa-miR-6731-5p	PAR-CLIP	22012620
MIRT531022	hsa-miR-8085	PAR-CLIP	22012620
MIRT531021	hsa-miR-6721-5p	PAR-CLIP	22012620
MIRT531020	hsa-miR-30c-1-3p	PAR-CLIP	22012620
MIRT531019	hsa-miR-30c-2-3p	PAR-CLIP	22012620
MIRT531018	hsa-miR-6788-5p	PAR-CLIP	22012620
MIRT531017	hsa-miR-1273h-5p	PAR-CLIP	22012620
MIRT531016	hsa-miR-30b-3p	PAR-CLIP	22012620
MIRT531015	hsa-miR-3689a-3p	PAR-CLIP	22012620
MIRT531014	hsa-miR-3689b-3p	PAR-CLIP	22012620
MIRT531013	hsa-miR-3689c	PAR-CLIP	22012620
MIRT531012	hsa-miR-6779-5p	PAR-CLIP	22012620
MIRT531011	hsa-miR-6780a-5p	PAR-CLIP	22012620
MIRT531010	hsa-miR-510-3p	PAR-CLIP	22012620
MIRT531009	hsa-miR-450a-1-3p	PAR-CLIP	22012620
MIRT531008	hsa-miR-3122	PAR-CLIP	22012620
MIRT531007	hsa-miR-3913-5p	PAR-CLIP	22012620
MIRT531006	hsa-miR-887-5p	PAR-CLIP	22012620
MIRT531005	hsa-miR-6513-5p	PAR-CLIP	22012620
MIRT531004	hsa-miR-129-5p	PAR-CLIP	22012620

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001568	Process	Blood vessel development	IBA
GO:0005576	Component	Extracellular region	IBA
GO:0005886	Component	Plasma membrane	IDA	18835250
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IDA	18835250
GO:0007165	Process	Signal transduction	IEA
GO:0007368	Process	Determination of left/right symmetry	IBA
GO:0007507	Process	Heart development	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	NAS	1882841
GO:0009952	Process	Anterior/posterior pattern specification	IBA
GO:0009986	Component	Cell surface	IBA
GO:0016020	Component	Membrane	IEA
GO:0038092	Process	Nodal signaling pathway	IBA
GO:0038100	Function	Nodal binding	IBA
GO:0070697	Function	Activin receptor binding	IBA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

P51864

Protein name

Protein CRIPTO3 (Cripto, EGF-CFC family member 3) (Cripto-3 growth factor) (Epidermal growth factor-like cripto protein CR3) (Teratocarcinoma-derived growth factor 1 pseudogene 3) (Teratocarcinoma-derived growth factor 3)

Protein function

Could play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm. Activates the Nodal-dependent signaling pathway.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09443	CFC	115 → 149	Cripto_Frl-1_Cryptic (CFC)	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed weakly in lung, colon and breast. Expressed also strongly in primary cancer tissues; lung and colon cancers. {ECO:0000269|PubMed:18835250}.

Sequence

MDCRKMVRFSYSVIWIMAISKAFELGLVAGLGHQEFARPSRGDLAFRDDSIWPQEEPAIR
PRSSQRVLPMGIQHSKELNRTCCLNGGTCMLESFCACPPSFYGRNCEHDVRKENCGSVPH
DTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLAGI
CLSIQSYY

Sequence length

188

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHOID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (54)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	1347673	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	2141558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	8536370	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	1382733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	39273179	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	38096369	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11553858, 15375551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16251206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	8144392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	27444932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	29604056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11553858, 24379580, 8302592, 9335455, 9816209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11553858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16525993	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24379580	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	8302592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	21863025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	29322530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	31577642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31577642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	21496809	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	28394345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29797206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	25629528, 30426531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25629528, 30426531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	25629528	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29679800, 30851330, 31401268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	31577642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	30851330, 31401268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	30910206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	2943542	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	Pubtator	2665844	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29604056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	29604056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	30586399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	27118513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16251206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28394345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15375551, 16251206, 18835250, 28394345, 29604056, 9815703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	24379580, 8302592, 9816209		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21863025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	31732929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25629528, 29604056, 8302592, 9285688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	8144392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	8144392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	18782328	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28394345, 31289621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	8635871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	8635871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	26654129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	38096369	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29797206, 31726162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	34067581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	33299869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CRIPTO3 (cripto, EGF-CFC family member 3)