CRIPTO (cripto, EGF-CFC family member)

Gene

• Entrez ID: 6997
• Gene name: Cripto, EGF-CFC family member
• Gene symbol: CRIPTO
• Synonyms (NCBI Gene): CR, CR-1, CRGF, TDGF1
• Chromosome: 3
• Chromosome location: 3p21.31

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1416955	hsa-miR-3122	CLIP-seq
MIRT1416956	hsa-miR-3148	CLIP-seq
MIRT1416957	hsa-miR-3153	CLIP-seq
MIRT1416958	hsa-miR-365	CLIP-seq
MIRT1416959	hsa-miR-374a	CLIP-seq
MIRT1416960	hsa-miR-374b	CLIP-seq
MIRT1416961	hsa-miR-3913-5p	CLIP-seq
MIRT1416962	hsa-miR-4668-5p	CLIP-seq
MIRT1416963	hsa-miR-532-5p	CLIP-seq
MIRT1416964	hsa-miR-1262	CLIP-seq
MIRT1416965	hsa-miR-1303	CLIP-seq
MIRT1416966	hsa-miR-3672	CLIP-seq
MIRT1416967	hsa-miR-3675-3p	CLIP-seq
MIRT1416968	hsa-miR-3978	CLIP-seq
MIRT1416969	hsa-miR-455-3p	CLIP-seq
MIRT1416970	hsa-miR-4684-5p	CLIP-seq
MIRT1416971	hsa-miR-4701-3p	CLIP-seq
MIRT1416972	hsa-miR-4786-5p	CLIP-seq
MIRT1416973	hsa-miR-4797-5p	CLIP-seq
MIRT1416974	hsa-miR-542-3p	CLIP-seq
MIRT1416975	hsa-miR-548c-3p	CLIP-seq
MIRT1416976	hsa-miR-630	CLIP-seq
MIRT1416977	hsa-miR-661	CLIP-seq
MIRT1416978	hsa-miR-759	CLIP-seq
MIRT2125058	hsa-miR-1827	CLIP-seq
MIRT2125059	hsa-miR-3689a-3p	CLIP-seq
MIRT2125060	hsa-miR-3689c	CLIP-seq
MIRT2125061	hsa-miR-3929	CLIP-seq
MIRT2125062	hsa-miR-4419b	CLIP-seq
MIRT2125063	hsa-miR-4478	CLIP-seq
MIRT2125064	hsa-miR-4643	CLIP-seq
MIRT2125065	hsa-miR-4649-3p	CLIP-seq
MIRT2125066	hsa-miR-4722-5p	CLIP-seq
MIRT2125067	hsa-miR-4728-5p	CLIP-seq
MIRT2125068	hsa-miR-4768-3p	CLIP-seq
MIRT2125069	hsa-miR-485-5p	CLIP-seq
MIRT2125070	hsa-miR-642b	CLIP-seq
MIRT2125071	hsa-miR-890	CLIP-seq
MIRT2125072	hsa-miR-935	CLIP-seq
MIRT2125073	hsa-miR-940	CLIP-seq
MIRT2347484	hsa-miR-193a-3p	CLIP-seq
MIRT2347485	hsa-miR-193b	CLIP-seq
MIRT2347486	hsa-miR-299-5p	CLIP-seq
MIRT2347487	hsa-miR-3614-5p	CLIP-seq
MIRT2347488	hsa-miR-3926	CLIP-seq
MIRT2347489	hsa-miR-4463	CLIP-seq
MIRT2347490	hsa-miR-4494	CLIP-seq
MIRT2125064	hsa-miR-4643	CLIP-seq
MIRT1416972	hsa-miR-4786-5p	CLIP-seq
MIRT2347491	hsa-miR-548s	CLIP-seq
MIRT2125070	hsa-miR-642b	CLIP-seq
MIRT2125071	hsa-miR-890	CLIP-seq
MIRT2125072	hsa-miR-935	CLIP-seq
MIRT2640423	hsa-miR-1285	CLIP-seq
MIRT2640424	hsa-miR-3187-5p	CLIP-seq
MIRT2640425	hsa-miR-3613-3p	CLIP-seq
MIRT2640426	hsa-miR-3622b-5p	CLIP-seq
MIRT1416967	hsa-miR-3675-3p	CLIP-seq
MIRT2125059	hsa-miR-3689a-3p	CLIP-seq
MIRT2125060	hsa-miR-3689c	CLIP-seq
MIRT2640427	hsa-miR-3945	CLIP-seq
MIRT2640428	hsa-miR-4253	CLIP-seq
MIRT1416970	hsa-miR-4684-5p	CLIP-seq
MIRT2125067	hsa-miR-4728-5p	CLIP-seq
MIRT1416975	hsa-miR-548c-3p	CLIP-seq
MIRT2640429	hsa-miR-612	CLIP-seq
MIRT2125071	hsa-miR-890	CLIP-seq
MIRT2125072	hsa-miR-935	CLIP-seq
MIRT2640423	hsa-miR-1285	CLIP-seq
MIRT2640424	hsa-miR-3187-5p	CLIP-seq
MIRT2640425	hsa-miR-3613-3p	CLIP-seq
MIRT1416967	hsa-miR-3675-3p	CLIP-seq
MIRT2640427	hsa-miR-3945	CLIP-seq
MIRT2640428	hsa-miR-4253	CLIP-seq
MIRT1416970	hsa-miR-4684-5p	CLIP-seq
MIRT1416975	hsa-miR-548c-3p	CLIP-seq
MIRT2640429	hsa-miR-612	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001568	Process	Blood vessel development	IBA
GO:0001763	Process	Morphogenesis of a branching structure	TAS	10070255
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IMP	17720976
GO:0005102	Function	Signaling receptor binding	IDA	11909953
GO:0005515	Function	Protein binding	IPI	12919325
GO:0005576	Component	Extracellular region	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	17720976
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IDA	8006041
GO:0007368	Process	Determination of left/right symmetry	IBA
GO:0007507	Process	Heart development	IBA
GO:0007507	Process	Heart development	IDA	9576836
GO:0008083	Function	Growth factor activity	IDA	8006041, 12925698
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	8006041
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	11857442
GO:0008595	Process	Anterior/posterior axis specification, embryo	ISS
GO:0009792	Process	Embryo development ending in birth or egg hatching	TAS	11857442
GO:0009952	Process	Anterior/posterior pattern specification	IBA
GO:0009966	Process	Regulation of signal transduction	IDA	12649175
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	12925698
GO:0010595	Process	Positive regulation of endothelial cell migration	IDA	17720976
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	17720976
GO:0030154	Process	Cell differentiation	TAS	11857442
GO:0030335	Process	Positive regulation of cell migration	IDA	12649175
GO:0030879	Process	Mammary gland development	TAS	11857442
GO:0035729	Process	Cellular response to hepatocyte growth factor stimulus	IDA	17720976
GO:0038092	Process	Nodal signaling pathway	IBA
GO:0038100	Function	Nodal binding	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	10493495
GO:0043406	Process	Positive regulation of MAP kinase activity	IDA	9013573
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	9013573
GO:0044344	Process	Cellular response to fibroblast growth factor stimulus	IDA	17720976
GO:0045121	Component	Membrane raft	IDA	17720976
GO:0070697	Function	Activin receptor binding	IBA
GO:0071346	Process	Cellular response to type II interferon	IDA	17720976
GO:0071354	Process	Cellular response to interleukin-6	IDA	17720976
GO:0071356	Process	Cellular response to tumor necrosis factor	IDA	17720976
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IDA	17720976
GO:0098552	Component	Side of membrane	IEA

Other IDs

• MIM: 187395
• HGNC: 11701
• e!Ensembl: ENSG00000241186

Protein

• UniProt ID: P13385
• Protein name: Protein Cripto (Cripto, EGF-CFC family member) (Cripto-1 growth factor) (CRGF) (Epidermal growth factor-like cripto protein CR1) (Teratocarcinoma-derived growth factor 1)
• Protein function: GPI-anchored cell membrane protein involved in Nodal signaling. Cell-associated CRIPTO acts as a Nodal coreceptor in cis. Shedding of CRIPTO by TMEM8A modulates Nodal signaling by allowing soluble CRIPTO to act as a Nodal coreceptor on other cel
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF09443	CFC	115 → 149	Cripto_Frl-1_Cryptic (CFC)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Preferentially expressed in gastric and colorectal carcinomas than in their normal counterparts. Expressed in breast and lung. {ECO:0000269|PubMed:18835250}.
• Sequence:

  MDCRKMARFSYSVIWIMAISKVFELGLVAGLGHQEFARPSRGYLAFRDDSIWPQEEPAIR
  PRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPH
  DTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLVGI
  CLSIQSYY

• Sequence length: 188

Pathways

Reactome:

POU5F1 (OCT4), SOX2, NANOG activate genes related to proliferation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CONGENITAL HEART DEFECTS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DISEASE	—	ClinGen, Disgenet, GWAS catalog ClinGen, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRIPTO-related disorder	Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Forebrain defects	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HETEROTAXY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HOLOPROSENCEPHALY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LOBAR HOLOPROSENCEPHALY	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MICROFORM HOLOPROSENCEPHALY	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIDDLE INTERHEMISPHERIC VARIANT OF HOLOPROSENCEPHALY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIDLINE INTERHEMISPHERIC VARIANT OF HOLOPROSENCEPHALY	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEMI-LOBAR HOLOPROSENCEPHALY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEMILOBAR HOLOPROSENCEPHALY	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPTOPREOPTIC HOLOPROSENCEPHALY	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TETRALOGY OF FALLOT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenoma	Adenoma	BEFREE	31692030		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Alobar Holoprosencephaly	Alobar Holoprosencephaly	CTD_human_DG	12073012		★☆☆☆☆ Found in Text Mining only
Alobar Holoprosencephaly	Alobar Holoprosencephaly	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Alobar holoprosencephaly	Alobar Holoprosencephaly	Orphanet			★☆☆☆☆ Found in Text Mining only
Ambiguous Genitalia	Ambiguous Genitalia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arhinencephaly	Arrhinencephaly	CTD_human_DG	12073012		★☆☆☆☆ Found in Text Mining only
Asplenia Syndrome	Asplenia	CTD_human_DG	11062482		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	19643405	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11553858, 15375551, 23129342		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17291450		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12679910	Inhibit	★☆☆☆☆ Found in Text Mining only
Choanal Atresia	Choanal Atresia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	29604056		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11553858, 24379580, 8302592, 9335455, 9816209		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17941089		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11553858, 20126975, 31692030		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	1715580, 35748788	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	1938601	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	8302592		★☆☆☆☆ Found in Text Mining only
Congenital absence of kidneys syndrome	Renal agenesis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital coloboma of iris	Congenital Coloboma Of Iris	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	19853938, 26811383		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital heart disease	Congenital Heart Disease	BEFREE	26811383		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital hypoplasia of penis	Congenital Hypoplasia Of Penis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	21863025		★☆☆☆☆ Found in Text Mining only
Cyclocephaly	Cyclocephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Duodenal atresia	Duodenal Atresia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	19874624	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	19643405		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	19643405, 25228630	Associate	★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	28394345		★☆☆☆☆ Found in Text Mining only
Forebrain Defects	Forebrain Defects	BEFREE	12073012		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Forebrain Defects	Forebrain Defects	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	1938601	Associate	★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	9285688		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	25629528, 30426531		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25629528, 30426531		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Heterotaxy Syndrome	Heterotaxia	CTD_human_DG	11062482		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Holoprosencephaly	Holoprosencephaly	CTD_human_DG	12073012		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Holoprosencephaly	Holoprosencephaly	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperaldosteronism	Hyperaldosteronism	Pubtator	20385969	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Left Atrial Isomerism	Left atrial isomerism	CTD_human_DG	11062482		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29604056		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	29604056		★☆☆☆☆ Found in Text Mining only
Lobar Holoprosencephaly	Lobar Holoprosencephaly	CTD_human_DG	12073012		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lobar Holoprosencephaly	Lobar Holoprosencephaly	ORPHANET_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lobar holoprosencephaly	Lobar Holoprosencephaly	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	23129342		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28394345		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15375551, 23129342, 28394345, 29604056, 9815703		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	24379580, 8302592, 9816209		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21863025		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Microform holoprosencephaly	Microform Holoprosencephaly	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Midline interhemispheric variant of holoprosencephaly	Midline Interhemispheric Variant Of Holoprosencephaly	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	11553858, 12147741, 25629528, 29604056, 8302592, 9285688		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10811499	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	8144392		★☆☆☆☆ Found in Text Mining only
Panhypopituitarism	Panhypopituitarism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Polysplenia Syndrome	Polysplenia	CTD_human_DG	11062482		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28394345, 31289621		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	25687871		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	8635871		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	8635871		★☆☆☆☆ Found in Text Mining only
Right Atrial Isomerism	Atrial Isomerism	CTD_human_DG	11062482		★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	40591616	Associate	★☆☆☆☆ Found in Text Mining only
Semilobar Holoprosencephaly	Semilobar Holoprosencephaly	CTD_human_DG	12073012		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Semilobar Holoprosencephaly	Semilobar Holoprosencephaly	ORPHANET_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Semilobar holoprosencephaly	Semilobar Holoprosencephaly	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seminoma	Seminoma	BEFREE	26654129		★☆☆☆☆ Found in Text Mining only
Septopreoptic holoprosencephaly	Septopreoptic Holoprosencephaly	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Situs ambiguus	Situs ambiguus	CTD_human_DG	11062482		★☆☆☆☆ Found in Text Mining only
SOLITARY MEDIAN MAXILLARY CENTRAL INCISOR	Fused incisors	HPO_DG			★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	18312357		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	1938601	Associate	★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	37508506	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	BEFREE	9285688		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	38158702	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34965257	Associate	★☆☆☆☆ Found in Text Mining only