Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6993
Gene name	Dynein light chain Tctex-type 1
Gene symbol	DYNLT1
Synonyms (NCBI Gene)	CW-1TCTEL1TCTEX1tctex-1
Chromosome	6
Chromosome location	6q25.3
Summary	This gene encodes a component of the motor complex, cytoplasmic dynein, which transports cellular cargo along microtubules in the cell. The encoded protein regulates the length of primary cilia which are sensory organelles found on the surface of cells. T

172

Show/Hide all (172)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043620	hsa-miR-326	CLASH	23622248
MIRT523964	hsa-miR-29c-3p	PAR-CLIP	21572407
MIRT523963	hsa-miR-29a-3p	PAR-CLIP	21572407
MIRT523962	hsa-miR-29b-3p	PAR-CLIP	21572407
MIRT238943	hsa-miR-3646	PAR-CLIP	21572407
MIRT523961	hsa-miR-6782-3p	PAR-CLIP	21572407
MIRT523960	hsa-miR-6871-3p	PAR-CLIP	21572407
MIRT523959	hsa-miR-6074	PAR-CLIP	21572407
MIRT523958	hsa-miR-892c-5p	PAR-CLIP	21572407
MIRT523957	hsa-miR-506-5p	PAR-CLIP	21572407
MIRT098975	hsa-miR-205-3p	PAR-CLIP	21572407
MIRT523956	hsa-miR-759	PAR-CLIP	21572407
MIRT523955	hsa-miR-10b-3p	PAR-CLIP	21572407
MIRT238940	hsa-miR-203a-3p	PAR-CLIP	21572407
MIRT523954	hsa-miR-585-5p	PAR-CLIP	21572407
MIRT523953	hsa-miR-5682	PAR-CLIP	21572407
MIRT523952	hsa-miR-5100	PAR-CLIP	21572407
MIRT523951	hsa-miR-374b-3p	PAR-CLIP	21572407
MIRT523950	hsa-miR-3942-3p	PAR-CLIP	21572407
MIRT523949	hsa-miR-510-3p	PAR-CLIP	21572407
MIRT523964	hsa-miR-29c-3p	PAR-CLIP	23446348
MIRT523963	hsa-miR-29a-3p	PAR-CLIP	23446348
MIRT523962	hsa-miR-29b-3p	PAR-CLIP	23446348
MIRT238943	hsa-miR-3646	PAR-CLIP	23446348
MIRT523961	hsa-miR-6782-3p	PAR-CLIP	23446348
MIRT523960	hsa-miR-6871-3p	PAR-CLIP	23446348
MIRT523959	hsa-miR-6074	PAR-CLIP	23446348
MIRT523958	hsa-miR-892c-5p	PAR-CLIP	23446348
MIRT523957	hsa-miR-506-5p	PAR-CLIP	23446348
MIRT098975	hsa-miR-205-3p	PAR-CLIP	23446348
MIRT523956	hsa-miR-759	PAR-CLIP	23446348
MIRT523955	hsa-miR-10b-3p	PAR-CLIP	23446348
MIRT238940	hsa-miR-203a-3p	PAR-CLIP	23446348
MIRT523954	hsa-miR-585-5p	PAR-CLIP	23446348
MIRT523953	hsa-miR-5682	PAR-CLIP	23446348
MIRT523952	hsa-miR-5100	PAR-CLIP	23446348
MIRT523951	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT523950	hsa-miR-3942-3p	PAR-CLIP	23446348
MIRT523949	hsa-miR-510-3p	PAR-CLIP	23446348
MIRT523964	hsa-miR-29c-3p	PAR-CLIP	21572407
MIRT523963	hsa-miR-29a-3p	PAR-CLIP	21572407
MIRT523962	hsa-miR-29b-3p	PAR-CLIP	21572407
MIRT238943	hsa-miR-3646	PAR-CLIP	21572407
MIRT523961	hsa-miR-6782-3p	PAR-CLIP	21572407
MIRT523960	hsa-miR-6871-3p	PAR-CLIP	21572407
MIRT523959	hsa-miR-6074	PAR-CLIP	21572407
MIRT523958	hsa-miR-892c-5p	PAR-CLIP	21572407
MIRT523957	hsa-miR-506-5p	PAR-CLIP	21572407
MIRT098975	hsa-miR-205-3p	PAR-CLIP	21572407
MIRT523956	hsa-miR-759	PAR-CLIP	21572407
MIRT523955	hsa-miR-10b-3p	PAR-CLIP	21572407
MIRT238940	hsa-miR-203a-3p	PAR-CLIP	21572407
MIRT523954	hsa-miR-585-5p	PAR-CLIP	21572407
MIRT523953	hsa-miR-5682	PAR-CLIP	21572407
MIRT523952	hsa-miR-5100	PAR-CLIP	21572407
MIRT523951	hsa-miR-374b-3p	PAR-CLIP	21572407
MIRT523950	hsa-miR-3942-3p	PAR-CLIP	21572407
MIRT523949	hsa-miR-510-3p	PAR-CLIP	21572407
MIRT523964	hsa-miR-29c-3p	PAR-CLIP	23446348
MIRT523963	hsa-miR-29a-3p	PAR-CLIP	23446348
MIRT523962	hsa-miR-29b-3p	PAR-CLIP	23446348
MIRT238943	hsa-miR-3646	PAR-CLIP	23446348
MIRT523961	hsa-miR-6782-3p	PAR-CLIP	23446348
MIRT523960	hsa-miR-6871-3p	PAR-CLIP	23446348
MIRT523959	hsa-miR-6074	PAR-CLIP	23446348
MIRT523958	hsa-miR-892c-5p	PAR-CLIP	23446348
MIRT523957	hsa-miR-506-5p	PAR-CLIP	23446348
MIRT098975	hsa-miR-205-3p	PAR-CLIP	23446348
MIRT523956	hsa-miR-759	PAR-CLIP	23446348
MIRT523955	hsa-miR-10b-3p	PAR-CLIP	23446348
MIRT238940	hsa-miR-203a-3p	PAR-CLIP	23446348
MIRT523954	hsa-miR-585-5p	PAR-CLIP	23446348
MIRT523953	hsa-miR-5682	PAR-CLIP	23446348
MIRT523952	hsa-miR-5100	PAR-CLIP	23446348
MIRT523951	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT523950	hsa-miR-3942-3p	PAR-CLIP	23446348
MIRT523949	hsa-miR-510-3p	PAR-CLIP	23446348
MIRT949349	hsa-miR-106a	CLIP-seq
MIRT949350	hsa-miR-106b	CLIP-seq
MIRT949351	hsa-miR-1238	CLIP-seq
MIRT949352	hsa-miR-128	CLIP-seq
MIRT949353	hsa-miR-138	CLIP-seq
MIRT949354	hsa-miR-17	CLIP-seq
MIRT949355	hsa-miR-20a	CLIP-seq
MIRT949356	hsa-miR-20b	CLIP-seq
MIRT949357	hsa-miR-2278	CLIP-seq
MIRT949358	hsa-miR-23a	CLIP-seq
MIRT949359	hsa-miR-23b	CLIP-seq
MIRT949360	hsa-miR-23c	CLIP-seq
MIRT949361	hsa-miR-27a	CLIP-seq
MIRT949362	hsa-miR-27b	CLIP-seq
MIRT949363	hsa-miR-29a	CLIP-seq
MIRT949364	hsa-miR-29b	CLIP-seq
MIRT949365	hsa-miR-29c	CLIP-seq
MIRT949366	hsa-miR-3125	CLIP-seq
MIRT949367	hsa-miR-323-5p	CLIP-seq
MIRT949368	hsa-miR-3605-5p	CLIP-seq
MIRT949369	hsa-miR-3611	CLIP-seq
MIRT949370	hsa-miR-3652	CLIP-seq
MIRT949371	hsa-miR-377	CLIP-seq
MIRT949372	hsa-miR-3916	CLIP-seq
MIRT949373	hsa-miR-3919	CLIP-seq
MIRT949374	hsa-miR-4280	CLIP-seq
MIRT949375	hsa-miR-4289	CLIP-seq
MIRT949376	hsa-miR-4430	CLIP-seq
MIRT949377	hsa-miR-4452	CLIP-seq
MIRT949378	hsa-miR-4456	CLIP-seq
MIRT949379	hsa-miR-4505	CLIP-seq
MIRT949380	hsa-miR-4704-5p	CLIP-seq
MIRT949381	hsa-miR-4732-5p	CLIP-seq
MIRT949382	hsa-miR-4756-3p	CLIP-seq
MIRT949383	hsa-miR-4760-3p	CLIP-seq
MIRT949384	hsa-miR-499-3p	CLIP-seq
MIRT949385	hsa-miR-499a-3p	CLIP-seq
MIRT949386	hsa-miR-519d	CLIP-seq
MIRT949387	hsa-miR-579	CLIP-seq
MIRT949388	hsa-miR-659	CLIP-seq
MIRT949389	hsa-miR-876-3p	CLIP-seq
MIRT949390	hsa-miR-877	CLIP-seq
MIRT949391	hsa-miR-93	CLIP-seq
MIRT1981306	hsa-miR-1250	CLIP-seq
MIRT949352	hsa-miR-128	CLIP-seq
MIRT949358	hsa-miR-23a	CLIP-seq
MIRT949359	hsa-miR-23b	CLIP-seq
MIRT949360	hsa-miR-23c	CLIP-seq
MIRT949361	hsa-miR-27a	CLIP-seq
MIRT949362	hsa-miR-27b	CLIP-seq
MIRT949384	hsa-miR-499-3p	CLIP-seq
MIRT949385	hsa-miR-499a-3p	CLIP-seq
MIRT949387	hsa-miR-579	CLIP-seq
MIRT949388	hsa-miR-659	CLIP-seq
MIRT2216326	hsa-miR-1205	CLIP-seq
MIRT2216327	hsa-miR-125a-3p	CLIP-seq
MIRT949353	hsa-miR-138	CLIP-seq
MIRT2216328	hsa-miR-192	CLIP-seq
MIRT2216329	hsa-miR-203	CLIP-seq
MIRT2216330	hsa-miR-215	CLIP-seq
MIRT949357	hsa-miR-2278	CLIP-seq
MIRT949363	hsa-miR-29a	CLIP-seq
MIRT949364	hsa-miR-29b	CLIP-seq
MIRT949365	hsa-miR-29c	CLIP-seq
MIRT949366	hsa-miR-3125	CLIP-seq
MIRT949367	hsa-miR-323-5p	CLIP-seq
MIRT2216331	hsa-miR-345	CLIP-seq
MIRT949368	hsa-miR-3605-5p	CLIP-seq
MIRT949370	hsa-miR-3652	CLIP-seq
MIRT2216332	hsa-miR-3665	CLIP-seq
MIRT2216333	hsa-miR-3688-5p	CLIP-seq
MIRT949371	hsa-miR-377	CLIP-seq
MIRT949372	hsa-miR-3916	CLIP-seq
MIRT949373	hsa-miR-3919	CLIP-seq
MIRT2216334	hsa-miR-3929	CLIP-seq
MIRT2216335	hsa-miR-4419b	CLIP-seq
MIRT2216336	hsa-miR-4428	CLIP-seq
MIRT949376	hsa-miR-4430	CLIP-seq
MIRT949378	hsa-miR-4456	CLIP-seq
MIRT2216337	hsa-miR-4478	CLIP-seq
MIRT949379	hsa-miR-4505	CLIP-seq
MIRT949380	hsa-miR-4704-5p	CLIP-seq
MIRT949381	hsa-miR-4732-5p	CLIP-seq
MIRT2216338	hsa-miR-4753-5p	CLIP-seq
MIRT949382	hsa-miR-4756-3p	CLIP-seq
MIRT2216339	hsa-miR-617	CLIP-seq
MIRT2216340	hsa-miR-657	CLIP-seq
MIRT949389	hsa-miR-876-3p	CLIP-seq
MIRT949390	hsa-miR-877	CLIP-seq
MIRT2387182	hsa-miR-208a	CLIP-seq
MIRT2387183	hsa-miR-208b	CLIP-seq
MIRT2387184	hsa-miR-3617	CLIP-seq
MIRT2387185	hsa-miR-4424	CLIP-seq
MIRT2387186	hsa-miR-499-5p	CLIP-seq
MIRT2387187	hsa-miR-641	CLIP-seq

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000132	Process	Establishment of mitotic spindle orientation	ISS
GO:0005515	Function	Protein binding	IPI	10644691, 15503857, 18647839, 25944661, 27173435, 32296183, 32814053, 33961781
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005819	Component	Spindle	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005868	Component	Cytoplasmic dynein complex	IBA
GO:0005868	Component	Cytoplasmic dynein complex	IDA	25205765
GO:0005868	Component	Cytoplasmic dynein complex	IPI	24986880
GO:0005868	Component	Cytoplasmic dynein complex	ISS
GO:0005874	Component	Microtubule	IEA
GO:0005881	Component	Cytoplasmic microtubule	IDA	21262767
GO:0007018	Process	Microtubule-based movement	IBA
GO:0007399	Process	Nervous system development	IEA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	ISS
GO:0019060	Process	Intracellular transport of viral protein in host cell	IMP	18647839
GO:0030286	Component	Dynein complex	IEA
GO:0032388	Process	Positive regulation of intracellular transport	NAS	33957056
GO:0034774	Component	Secretory granule lumen	TAS
GO:0042802	Function	Identical protein binding	IPI	17965411
GO:0043657	Component	Host cell	IEA
GO:0045505	Function	Dynein intermediate chain binding	IBA
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0050768	Process	Negative regulation of neurogenesis	ISS
GO:0051301	Process	Cell division	IEA
GO:0075521	Process	Microtubule-dependent intracellular transport of viral material towards nucleus	IEA
GO:0075606	Process	Transport of viral material towards nucleus	IEA
GO:0099503	Component	Secretory vesicle	IDA	21262767
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
601554	11697	ENSG00000146425

P63172

Protein name

Dynein light chain Tctex-type 1 (Protein CW-1) (T-complex testis-specific protein 1 homolog)

Protein function

Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor

PDB

5JPW , 8J07 , 8PR0 , 8PR1 , 8PTK , 8RGI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03645	Tctex-1	16 → 112	Tctex-1 family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in heart, placenta, skeletal muscle kidney, pancreas, spleen, prostate, testis, ovary, ileum and colon. Expressed in lung endothelial and smooth muscle cells (at protein level). {ECO:0000269|PubMed:14583445}.

Sequence

MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKP
FKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI

Sequence length

113

Interactions

View interactions

	KEGG		Reactome
	Motor proteins Salmonella infection		Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	23006766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35919504	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	14583445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	14583445		★★★★★ ★☆☆☆☆ Found in Text Mining only

DYNLT1 (dynein light chain Tctex-type 1)