TCP1 (t-complex 1)

Gene

• Entrez ID: 6950
• Gene name: T-complex 1
• Gene symbol: TCP1
• Synonyms (NCBI Gene): CCT-alpha, CCT1, CCTa, D6S230E, IDDPMGS, TCP-1-alpha
• Chromosome: 6
• Chromosome location: 6q25.3
• Summary: The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different p

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT051234	hsa-miR-16-5p	CLASH	23622248
MIRT050683	hsa-miR-18a-5p	CLASH	23622248
MIRT050084	hsa-miR-26a-5p	CLASH	23622248
MIRT048447	hsa-miR-100-5p	CLASH	23622248
MIRT046434	hsa-miR-15b-5p	CLASH	23622248
MIRT046287	hsa-miR-23b-3p	CLASH	23622248
MIRT045307	hsa-miR-186-5p	CLASH	23622248
MIRT044438	hsa-miR-320a	CLASH	23622248
MIRT043872	hsa-miR-378a-3p	CLASH	23622248
MIRT043731	hsa-miR-342-3p	CLASH	23622248
MIRT043392	hsa-miR-331-3p	CLASH	23622248
MIRT039658	hsa-miR-615-3p	CLASH	23622248
MIRT039658	hsa-miR-615-3p	CLASH	23622248
MIRT039480	hsa-miR-652-3p	CLASH	23622248
MIRT732981	hsa-miR-34a-3p	Immunohistochemistry (IHC), Western blotting	33500737
MIRT1416722	hsa-miR-200b	CLIP-seq
MIRT1416723	hsa-miR-200c	CLIP-seq
MIRT1416724	hsa-miR-2054	CLIP-seq
MIRT1416725	hsa-miR-3143	CLIP-seq
MIRT1416726	hsa-miR-33a	CLIP-seq
MIRT1416727	hsa-miR-33b	CLIP-seq
MIRT1416728	hsa-miR-429	CLIP-seq
MIRT1416729	hsa-miR-4761-5p	CLIP-seq
MIRT1416730	hsa-miR-543	CLIP-seq
MIRT1416731	hsa-miR-888	CLIP-seq
MIRT1416722	hsa-miR-200b	CLIP-seq
MIRT1416723	hsa-miR-200c	CLIP-seq
MIRT1416724	hsa-miR-2054	CLIP-seq
MIRT1416725	hsa-miR-3143	CLIP-seq
MIRT1416726	hsa-miR-33a	CLIP-seq
MIRT1416727	hsa-miR-33b	CLIP-seq
MIRT2124963	hsa-miR-340	CLIP-seq
MIRT1416728	hsa-miR-429	CLIP-seq
MIRT1416729	hsa-miR-4761-5p	CLIP-seq
MIRT1416730	hsa-miR-543	CLIP-seq
MIRT1416731	hsa-miR-888	CLIP-seq
MIRT2347440	hsa-miR-3973	CLIP-seq
MIRT2347441	hsa-miR-4257	CLIP-seq
MIRT2347442	hsa-miR-4501	CLIP-seq
MIRT2347443	hsa-miR-4751	CLIP-seq
MIRT2347444	hsa-miR-548k	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000242	Component	Pericentriolar material	IEA
GO:0000792	Component	Heterochromatin	IEA
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0002199	Component	Zona pellucida receptor complex	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0005515	Function	Protein binding	IPI	14532270, 16085932, 16097032, 21098288, 24846140, 25416956, 25467444, 29477555, 30021884, 31470122, 32814053, 33144677, 33961781, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005813	Component	Centrosome	IDA	20080638
GO:0005813	Component	Centrosome	IEA
GO:0005815	Component	Microtubule organizing center	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS	1630491
GO:0005832	Component	Chaperonin-containing T-complex	IBA
GO:0005832	Component	Chaperonin-containing T-complex	IDA	23011926, 25467444, 30955883
GO:0005832	Component	Chaperonin-containing T-complex	IEA
GO:0005832	Component	Chaperonin-containing T-complex	IPI	22133715
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IDA	21525035
GO:0005874	Component	Microtubule	IEA
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IDA	22133715, 30955883
GO:0006457	Process	Protein folding	IEA
GO:0006457	Process	Protein folding	IMP	25467444
GO:0006457	Process	Protein folding	TAS	1630491
GO:0007021	Process	Tubulin complex assembly	NAS	11532003
GO:0007339	Process	Binding of sperm to zona pellucida	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	21753002
GO:0032212	Process	Positive regulation of telomere maintenance via telomerase	IEA
GO:0032212	Process	Positive regulation of telomere maintenance via telomerase	IMP	25467444
GO:0044183	Function	Protein folding chaperone	IDA	25467444, 30955883
GO:0044183	Function	Protein folding chaperone	IEA
GO:0044297	Component	Cell body	IEA
GO:0050821	Process	Protein stabilization	IEA
GO:0050821	Process	Protein stabilization	IMP	25467444
GO:0051082	Function	Unfolded protein binding	IBA
GO:0051082	Function	Unfolded protein binding	IEA
GO:0051082	Function	Unfolded protein binding	TAS	1630491
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0090666	Process	ScaRNA localization to Cajal body	IMP	25467444
GO:0140535	Component	Intracellular protein-containing complex	IEA
GO:0140662	Function	ATP-dependent protein folding chaperone	IEA
GO:1904851	Process	Positive regulation of establishment of protein localization to telomere	IMP	25467444
GO:1904871	Process	Positive regulation of protein localization to Cajal body	HMP	25467444
GO:1904874	Process	Positive regulation of telomerase RNA localization to Cajal body	IMP	25467444

Other IDs

• MIM: 186980
• HGNC: 11655
• e!Ensembl: ENSG00000120438

Protein

• UniProt ID: P17987
• Protein name: T-complex protein 1 subunit alpha (TCP-1-alpha) (EC 3.6.1.-) (CCT-alpha) (Chaperonin containing T-complex polypeptide 1 subunit 1)
• Protein function: Component of the chaperonin-containing T-complex (TRiC), a molecular chaperone complex that assists the folding of actin, tubulin and other proteins upon ATP hydrolysis (PubMed:25467444, PubMed:36493755, PubMed:35449234, PubMed:37193829). The TR
• PDB: 6NR8, 6NR9, 6NRA, 6NRB, 6NRC, 6NRD, 6QB8, 7LUM, 7LUP, 7NVL, 7NVM, 7NVN, 7NVO, 7TRG, 7TTN, 7TTT, 7TUB, 7WU7, 7WZ3, 7X0A, 7X0S, 7X0V, 7X3J, 7X3U, 7X6Q, 7X7Y, 8HKI, 8I1U, 8I9U, 8IB8, 8SFE, 8SFF, 8SG8, 8SG9, 8SGC, 8SGL, 8SGQ, 8SH9, 8SHA, 8SHD, 8SHE, 8SHF, 8SHG, 8SHL, 8SHN, 8SHO, 8SHP, 8SHQ, 8SHT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00118	Cpn60_TCP1	28 → 535	TCP-1/cpn60 chaperonin family	Family

• Sequence:

  MEGPLSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGAT
  ILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISG
  YRLACKEAVRYINENLIVNTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIK
  YTDIRGQPRYPVNSVNILKAHGRSQMESMLISGYALNCVVGSQGMPKRIVNAKIACLDFS
  LQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYF
  VEAGAMAVRRVLKRDLKRIAKASGATILSTLANLEGEETFEAAMLGQAEEVVQERICDDE
  LILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALS
  IYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPER
  KNLKWIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDD
  KHGSYEDAVHSGALND

• Sequence length: 556

Pathways

Reactome:

Association of TriC/CCT with target proteins during biosynthesis
BBSome-mediated cargo-targeting to cilium
Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding
Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Colon adenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DEVELOPMENTAL DISORDER WITH POLYMICROGYRIA AND SEIZURES	—	ClinVar, Disgenet, HPO ClinVar, Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDER	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	16981251		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	22513979		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29475387		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25704758, 27012814		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27012814, 31101846, 34868337, 35120331, 37818090	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26229401, 34612153	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30942452		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	34162426	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	19132087	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	30049566		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16981251, 20872946		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28407768, 30224034, 30366860, 31302028		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28329376, 28407768, 28549614, 30366860		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28407768, 30366860		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	BEFREE	31696294		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	26781905		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	11771755		★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	21098288		★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	21098288	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30451371		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30451371		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myopathy, Sporadic	Inclusion body myopathy	BEFREE	31644823		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31825490		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	30559292		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24040354, 30473171, 31819524		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	39201300	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	26556873		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	26556873		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25704758, 27012814		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30942452		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17566973		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	27555670		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26304164, 28455266		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	31413263		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	19132087	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	27838131, 30060671		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	30224034, 31302028		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27287890, 28970092		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	30931649		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	23255072		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34162426	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17566973		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinal Dystrophies	Retinal Dystrophy	BEFREE	30559292		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	16465465		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	39201300	Associate	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	34612770	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	31413263		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	27555670		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	27555670		★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	11865071		★☆☆☆☆ Found in Text Mining only