TCF21 (transcription factor 21)

Gene

• Entrez ID: 6943
• Gene name: Transcription factor 21
• Gene symbol: TCF21
• Synonyms (NCBI Gene): POD1, bHLHa23
• Chromosome: 6
• Chromosome location: 6q23.2
• Summary: TCF21 encodes a transcription factor of the basic helix-loop-helix family. The TCF21 product is mesoderm specific, and expressed in embryonic epicardium, mesenchyme-derived tissues of lung, gut, gonad, and both mesenchymal and glomerular epithelial cells

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006075	hsa-miR-492	Microarray, qRT-PCR	21319197
MIRT006075	hsa-miR-492	Microarray, qRT-PCR	21319197
MIRT006075	hsa-miR-492	Microarray, qRT-PCR	21319197
MIRT007085	hsa-miR-21-5p	Luciferase reporter assay	23206776
MIRT007085	hsa-miR-21-5p	Luciferase reporter assay	23206776
MIRT025053	hsa-miR-181a-5p	Microarray	17612493
MIRT492086	hsa-miR-5088-5p	PAR-CLIP	23592263
MIRT492085	hsa-miR-1234-3p	PAR-CLIP	23592263
MIRT492084	hsa-miR-7107-5p	PAR-CLIP	23592263
MIRT492082	hsa-miR-4721	PAR-CLIP	23592263
MIRT492083	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT492081	hsa-miR-6735-3p	PAR-CLIP	23592263
MIRT492086	hsa-miR-5088-5p	PAR-CLIP	23592263
MIRT492085	hsa-miR-1234-3p	PAR-CLIP	23592263
MIRT492084	hsa-miR-7107-5p	PAR-CLIP	23592263
MIRT492082	hsa-miR-4721	PAR-CLIP	23592263
MIRT492083	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT492081	hsa-miR-6735-3p	PAR-CLIP	23592263
MIRT1416102	hsa-miR-1279	CLIP-seq
MIRT1416103	hsa-miR-142-3p	CLIP-seq
MIRT1416104	hsa-miR-147	CLIP-seq
MIRT1416105	hsa-miR-148a	CLIP-seq
MIRT1416106	hsa-miR-148b	CLIP-seq
MIRT1416107	hsa-miR-152	CLIP-seq
MIRT1416108	hsa-miR-15a	CLIP-seq
MIRT1416109	hsa-miR-15b	CLIP-seq
MIRT1416110	hsa-miR-16	CLIP-seq
MIRT1416111	hsa-miR-195	CLIP-seq
MIRT1416112	hsa-miR-3074-5p	CLIP-seq
MIRT1416113	hsa-miR-3160-5p	CLIP-seq
MIRT1416114	hsa-miR-3170	CLIP-seq
MIRT1416115	hsa-miR-3189-3p	CLIP-seq
MIRT1416116	hsa-miR-342-5p	CLIP-seq
MIRT1416117	hsa-miR-3612	CLIP-seq
MIRT1416118	hsa-miR-3622a-3p	CLIP-seq
MIRT1416119	hsa-miR-3622b-3p	CLIP-seq
MIRT1416120	hsa-miR-3650	CLIP-seq
MIRT1416121	hsa-miR-3908	CLIP-seq
MIRT1416122	hsa-miR-3911	CLIP-seq
MIRT1416123	hsa-miR-3913-3p	CLIP-seq
MIRT1416124	hsa-miR-424	CLIP-seq
MIRT1416125	hsa-miR-4255	CLIP-seq
MIRT1416126	hsa-miR-4259	CLIP-seq
MIRT1416127	hsa-miR-4311	CLIP-seq
MIRT1416128	hsa-miR-4324	CLIP-seq
MIRT1416129	hsa-miR-4326	CLIP-seq
MIRT1416130	hsa-miR-4328	CLIP-seq
MIRT1416131	hsa-miR-4329	CLIP-seq
MIRT1416132	hsa-miR-4530	CLIP-seq
MIRT1416133	hsa-miR-4651	CLIP-seq
MIRT1416134	hsa-miR-4664-5p	CLIP-seq
MIRT1416135	hsa-miR-4697-3p	CLIP-seq
MIRT1416136	hsa-miR-4712-3p	CLIP-seq
MIRT1416137	hsa-miR-4722-3p	CLIP-seq
MIRT1416138	hsa-miR-489	CLIP-seq
MIRT1416139	hsa-miR-497	CLIP-seq
MIRT1416140	hsa-miR-499-3p	CLIP-seq
MIRT1416141	hsa-miR-499a-3p	CLIP-seq
MIRT1416142	hsa-miR-520f	CLIP-seq
MIRT1416143	hsa-miR-541	CLIP-seq
MIRT1416144	hsa-miR-548n	CLIP-seq
MIRT1416145	hsa-miR-548t	CLIP-seq
MIRT1416146	hsa-miR-608	CLIP-seq
MIRT1416147	hsa-miR-634	CLIP-seq
MIRT1416148	hsa-miR-644	CLIP-seq
MIRT1416149	hsa-miR-650	CLIP-seq
MIRT1416150	hsa-miR-654-5p	CLIP-seq
MIRT2347244	hsa-miR-1305	CLIP-seq
MIRT2347245	hsa-miR-4737	CLIP-seq
MIRT1416144	hsa-miR-548n	CLIP-seq
MIRT2347246	hsa-miR-548p	CLIP-seq
MIRT2347247	hsa-miR-562	CLIP-seq
MIRT2347248	hsa-miR-607	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	12493738
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	12493738
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS
GO:0001657	Process	Ureteric bud development	IEA
GO:0001657	Process	Ureteric bud development	ISS
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	ISS
GO:0001763	Process	Morphogenesis of a branching structure	IEA
GO:0001763	Process	Morphogenesis of a branching structure	ISS
GO:0001822	Process	Kidney development	IEA
GO:0001822	Process	Kidney development	ISS
GO:0001944	Process	Vasculature development	IEA
GO:0001944	Process	Vasculature development	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005634	Component	Nucleus	IDA	12493738
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007530	Process	Sex determination	IEA
GO:0007530	Process	Sex determination	ISS
GO:0007548	Process	Sex differentiation	IEA
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0014707	Process	Branchiomeric skeletal muscle development	IEA
GO:0014707	Process	Branchiomeric skeletal muscle development	ISS
GO:0030855	Process	Epithelial cell differentiation	IEA
GO:0030855	Process	Epithelial cell differentiation	ISS
GO:0032502	Process	Developmental process	IBA
GO:0032835	Process	Glomerulus development	IEA
GO:0032835	Process	Glomerulus development	ISS
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0043425	Function	BHLH transcription factor binding	IEA
GO:0043425	Function	BHLH transcription factor binding	IPI	12493738
GO:0043425	Function	BHLH transcription factor binding	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048286	Process	Lung alveolus development	IEA
GO:0048286	Process	Lung alveolus development	ISS
GO:0048536	Process	Spleen development	IEA
GO:0048536	Process	Spleen development	ISS
GO:0048557	Process	Embryonic digestive tract morphogenesis	IEA
GO:0048557	Process	Embryonic digestive tract morphogenesis	ISS
GO:0048608	Process	Reproductive structure development	IEA
GO:0048608	Process	Reproductive structure development	ISS
GO:0048732	Process	Gland development	IEA
GO:0048732	Process	Gland development	ISS
GO:0050681	Function	Nuclear androgen receptor binding	IEA
GO:0050681	Function	Nuclear androgen receptor binding	ISS
GO:0060008	Process	Sertoli cell differentiation	IEA
GO:0060008	Process	Sertoli cell differentiation	ISS
GO:0060021	Process	Roof of mouth development	IEA
GO:0060021	Process	Roof of mouth development	ISS
GO:0060425	Process	Lung morphogenesis	IEA
GO:0060425	Process	Lung morphogenesis	ISS
GO:0060426	Process	Lung vasculature development	IEA
GO:0060426	Process	Lung vasculature development	ISS
GO:0060435	Process	Bronchiole development	IEA
GO:0060435	Process	Bronchiole development	ISS
GO:0060539	Process	Diaphragm development	IEA
GO:0060539	Process	Diaphragm development	ISS
GO:0060541	Process	Respiratory system development	IEA
GO:0060541	Process	Respiratory system development	ISS
GO:0060766	Process	Negative regulation of androgen receptor signaling pathway	IEA
GO:0060766	Process	Negative regulation of androgen receptor signaling pathway	ISS
GO:0070888	Function	E-box binding	IEA
GO:0070888	Function	E-box binding	ISS
GO:0072162	Process	Metanephric mesenchymal cell differentiation	IEA
GO:0072162	Process	Metanephric mesenchymal cell differentiation	ISS
GO:0072277	Process	Metanephric glomerular capillary formation	IEA
GO:0072277	Process	Metanephric glomerular capillary formation	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 603306
• HGNC: 11632
• e!Ensembl: ENSG00000118526

Protein

• UniProt ID: O43680
• Protein name: Transcription factor 21 (TCF-21) (Capsulin) (Class A basic helix-loop-helix protein 23) (bHLHa23) (Epicardin) (Podocyte-expressed 1) (Pod-1)
• Protein function: Involved in epithelial-mesenchymal interactions in kidney and lung morphogenesis that include epithelial differentiation and branching morphogenesis. May play a role in the specification or differentiation of one or more subsets of epicardial ce
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00010	HLH	80 → 132	Helix-loop-helix DNA-binding domain	Domain

• Sequence:

  MSTGSLSDVEDLQEVEMLECDGLKMDSNKEFVTSNESTEESSNCENGSPQKGRGGLGKRR
  KAPTKKSPLSGVSQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDT
  LRLASSYIAHLRQILANDKYENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS

• Sequence length: 179

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ATHEROSCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LARGE ARTERY STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TCF21-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR SEPTAL DEFECTS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	20945327		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28515486		★☆☆☆☆ Found in Text Mining only
Adrenal cortical hypofunction	Adrenal Cortical Hypofunction	BEFREE	30835697		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	22266195, 23313103, 28658440		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	28658440	Associate	★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	23313103		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	30307970		★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	38250610	Associate	★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	23313103		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	24573017, 24676100, 26020271, 31354385		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	24573017, 24676100, 26020271, 31354385		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24676100, 31815603, 37391023	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	21847011		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26044559, 27270650		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26044559, 27028856	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27270650, 32894086	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Urinary Tract	Urinary Tract Cancer	BEFREE	21847011		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16415157, 29520253		★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	27270650	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31014118	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33985545	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	21847011		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27894084, 29086202, 30176158, 30662806		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	21847011, 29080283	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	38084139	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28476165, 30857227, 31241128		★☆☆☆☆ Found in Text Mining only
Cardiac defects	Cardiac Defects	BEFREE	28346832		★☆☆☆☆ Found in Text Mining only
Carotid Artery Thrombosis	Carotid artery thrombosis	Pubtator	35910838	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GWASCAT_DG	24262325		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	30920845		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	30920845	Inhibit	★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	28124458		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30322713		★☆☆☆☆ Found in Text Mining only
Clear cell sarcoma of kidney	Sarcoma Of Kidney	BEFREE	26158413, 29080283		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26435499, 28352192, 28740457, 30187278		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	38197316	Associate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	30920845		★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	28346832		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	22862160, 23206776, 29080283		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	21378990, 22751097		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	24676100, 26020271, 26020946, 26909569, 28059143, 28346832, 30307970, 31014396		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	21378990, 22751097		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASDB_DG	23202125, 24262325		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	24676100, 26020271, 26020946, 26909569, 28059143, 28346832, 28481916, 30307970, 31014396, 31359001, 31815603		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	24676100, 26020271, 30146127, 30307970, 31014396, 32513244, 36345357, 37391023, 38250610	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	31815603	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE, AUTOSOMAL DOMINANT, 1	Coronary artery disease	GWASDB_DG	23202125		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	23874238, 24676100, 28346832, 31014396, 31815603, 32513244	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	21378990		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	GWASCAT_DG	21378990, 24262325		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	23874238, 24676100, 26020271, 26020946, 26909569, 28059143, 28346832, 30307970, 31014396		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	BEFREE	29912382		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	21771727		★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	29605752		★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	30948695		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29529645		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29529645, 30358649		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37391023, 38250610	Associate	★☆☆☆☆ Found in Text Mining only
Double Outlet Right Ventricle	Double outlet right ventricle	Pubtator	28346832	Associate	★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	27270650		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	27270650		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30018006, 31610174		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	31610174, 36650372	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	29909422		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	29909422		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	29909422	Inhibit	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32487238	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	29909422	Inhibit	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31549421		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	38278877	Stimulate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	16415157		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	16415157		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	18398044, 20945327, 21771727	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	28346832	Associate	★☆☆☆☆ Found in Text Mining only
Heart Septal Defects Ventricular	Congenital heart septal defect	Pubtator	28346832	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29598945, 30704771		★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	38250610	Associate	★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	BEFREE	28906021		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	38250610	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoparathyroidism	Hypoparathyroidism	BEFREE	28906021		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	26020271		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	26020271	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30322713		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	28124458		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	29080283		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	29080283	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	31312357		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26421305, 31014118		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	37268177	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18398044, 19017733, 20945327, 30176158	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26044559	Inhibit	★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	16415157		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26044559, 27270650		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	29909422		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	23206776, 29080283		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	16415157, 20945327, 27894084, 29086202, 30176158, 30662806		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28476165, 30857227, 31241128		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21847011		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25156819, 31242936		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	21847011		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16415157, 18398044, 20945327, 21771727, 27270650, 28663539, 29520253, 29608330		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	31592889		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21771727		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21771727, 34424910	Inhibit	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	21771727		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	31312357		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16415157, 18398044, 20945327, 21771727, 22862160, 23529585, 25087872, 25156819, 26044559, 26158413, 26435499, 27270650, 28352192, 28658440, 28663539, 29080283, 29086202, 29520253, 29529645, 29608330, 29909422, 30617255, 30857227, 30862575, 30920845, 31014118, 31312357		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20945327, 29086202		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	26273678, 29478099		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26273678	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	28799964		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28663539, 30804710		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	28663539	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	30857227		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	31610174	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28476165, 31241128		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28476165, 32434219, 35183243	Associate	★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	31733206		★☆☆☆☆ Found in Text Mining only
Phosphate Diabetes	Phosphate Diabetes	BEFREE	28690207		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21847011		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21847011	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	27451010		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	23206776, 29080283		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23206776		★☆☆☆☆ Found in Text Mining only
Renal Cell Dysplasia	Renal dysplasia	BEFREE	30377232		★☆☆☆☆ Found in Text Mining only
Renal dysplasia	Renal dysplasia	BEFREE	30377232		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	31111072		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	29529645		★☆☆☆☆ Found in Text Mining only
Sarcoma Clear Cell	Sarcoma	Pubtator	26158413, 29080283	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30721450		★☆☆☆☆ Found in Text Mining only
SMITH-MCCORT DYSPLASIA 1	Smith-McCort Dysplasia	BEFREE	31815603		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16415157, 30615266		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29909422		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	21563216, 23529585		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25156819, 31242936		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	29111402		★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	28405149, 31815829		★☆☆☆☆ Found in Text Mining only
Tumors of Adrenal Cortex	Tumors Of Adrenal Cortex	BEFREE	23313103, 26421305, 28658440		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	21847011	Associate	★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic neoplasm	Pubtator	21847011	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	28346832		★★☆☆☆ Found in Text Mining + Unknown/Other Associations