TCF19 (transcription factor 19)

Gene

• Entrez ID: 6941
• Gene name: Transcription factor 19
• Gene symbol: TCF19
• Synonyms (NCBI Gene): SC1, TCF-19
• Chromosome: 6
• Chromosome location: 6p21.33
• Summary: This gene encodes a protein that contains a PHD-type zinc finger domain and likely functions as a transcription factor. The encoded protein plays a role proliferation and apoptosis of pancreatic beta cells. Alternative splicing results in multiple transcr

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT048303	hsa-miR-107	CLASH	23622248
MIRT041802	hsa-miR-484	CLASH	23622248
MIRT439113	hsa-miR-10b-5p	3'LIFE	25074381
MIRT439113	hsa-miR-10b-5p	3'LIFE	25074381
MIRT1416008	hsa-miR-1182	CLIP-seq
MIRT1416009	hsa-miR-1236	CLIP-seq
MIRT1416010	hsa-miR-1291	CLIP-seq
MIRT1416011	hsa-miR-3120-5p	CLIP-seq
MIRT1416012	hsa-miR-3140-5p	CLIP-seq
MIRT1416013	hsa-miR-3150a-3p	CLIP-seq
MIRT1416014	hsa-miR-3175	CLIP-seq
MIRT1416015	hsa-miR-3179	CLIP-seq
MIRT1416016	hsa-miR-3182	CLIP-seq
MIRT1416017	hsa-miR-3187-3p	CLIP-seq
MIRT1416018	hsa-miR-3194-3p	CLIP-seq
MIRT1416019	hsa-miR-3202	CLIP-seq
MIRT1416020	hsa-miR-345	CLIP-seq
MIRT1416021	hsa-miR-3907	CLIP-seq
MIRT1416022	hsa-miR-4299	CLIP-seq
MIRT1416023	hsa-miR-431	CLIP-seq
MIRT1416024	hsa-miR-4435	CLIP-seq
MIRT1416025	hsa-miR-4456	CLIP-seq
MIRT1416026	hsa-miR-4527	CLIP-seq
MIRT1416027	hsa-miR-4645-5p	CLIP-seq
MIRT1416028	hsa-miR-4667-5p	CLIP-seq
MIRT1416029	hsa-miR-4673	CLIP-seq
MIRT1416030	hsa-miR-4700-5p	CLIP-seq
MIRT1416031	hsa-miR-4701-5p	CLIP-seq
MIRT1416032	hsa-miR-4728-5p	CLIP-seq
MIRT1416033	hsa-miR-4733-3p	CLIP-seq
MIRT1416034	hsa-miR-4747-5p	CLIP-seq
MIRT1416035	hsa-miR-4778-5p	CLIP-seq
MIRT1416036	hsa-miR-548q	CLIP-seq
MIRT1416037	hsa-miR-548s	CLIP-seq
MIRT1416038	hsa-miR-588	CLIP-seq
MIRT1416039	hsa-miR-767-3p	CLIP-seq
MIRT1416040	hsa-miR-939	CLIP-seq
MIRT1416041	hsa-miR-1273d	CLIP-seq
MIRT1416042	hsa-miR-145	CLIP-seq
MIRT1416043	hsa-miR-3180-5p	CLIP-seq
MIRT1416044	hsa-miR-4267	CLIP-seq
MIRT1416045	hsa-miR-4712-5p	CLIP-seq
MIRT1416046	hsa-miR-507	CLIP-seq
MIRT1416047	hsa-miR-557	CLIP-seq
MIRT1416048	hsa-miR-766	CLIP-seq
MIRT1416049	hsa-miR-770-5p	CLIP-seq
MIRT2124793	hsa-miR-1322	CLIP-seq
MIRT2124794	hsa-miR-1343	CLIP-seq
MIRT2124795	hsa-miR-3074-5p	CLIP-seq
MIRT2124796	hsa-miR-3688-5p	CLIP-seq
MIRT2124797	hsa-miR-3689d	CLIP-seq
MIRT2124798	hsa-miR-3690	CLIP-seq
MIRT2124799	hsa-miR-4254	CLIP-seq
MIRT2124800	hsa-miR-4759	CLIP-seq
MIRT2124801	hsa-miR-4797-5p	CLIP-seq
MIRT2124802	hsa-miR-514	CLIP-seq
MIRT2124803	hsa-miR-514b-3p	CLIP-seq
MIRT2347208	hsa-miR-1224-3p	CLIP-seq
MIRT2347209	hsa-miR-1260	CLIP-seq
MIRT2347210	hsa-miR-1260b	CLIP-seq
MIRT2347211	hsa-miR-1262	CLIP-seq
MIRT2347212	hsa-miR-1280	CLIP-seq
MIRT2347213	hsa-miR-129-5p	CLIP-seq
MIRT2347214	hsa-miR-188-3p	CLIP-seq
MIRT2347215	hsa-miR-3119	CLIP-seq
MIRT2347216	hsa-miR-3156-3p	CLIP-seq
MIRT2347217	hsa-miR-3160-5p	CLIP-seq
MIRT2347218	hsa-miR-3189-3p	CLIP-seq
MIRT2347219	hsa-miR-4312	CLIP-seq
MIRT2347220	hsa-miR-4701-3p	CLIP-seq
MIRT2347221	hsa-miR-532-5p	CLIP-seq
MIRT2395586	hsa-miR-122	CLIP-seq
MIRT2395587	hsa-miR-3657	CLIP-seq
MIRT2395588	hsa-miR-4633-3p	CLIP-seq
MIRT2395589	hsa-miR-4669	CLIP-seq
MIRT2640058	hsa-miR-1301	CLIP-seq
MIRT2640059	hsa-miR-4480	CLIP-seq
MIRT2640060	hsa-miR-5047	CLIP-seq
MIRT2640058	hsa-miR-1301	CLIP-seq
MIRT2640059	hsa-miR-4480	CLIP-seq
MIRT2640060	hsa-miR-5047	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21516116, 28514442, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 600912
• HGNC: 11629
• e!Ensembl: ENSG00000137310

Protein

• UniProt ID: Q9Y242
• Protein name: Transcription factor 19 (TCF-19) (Transcription factor SC1)
• Protein function: Potential transcription factor that may play a role in the regulation of genes involved in cell cycle G1/S transition (PubMed:1868030, PubMed:31141247). May bind to regulatory elements of genes, including the promoter of the transcription factor
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00498	FHA	31 → 105	FHA domain	Family

• Sequence:

  MLPCFQLLRIGGGRGGDLYTFHPPAGAGCTYRLGHRADLCDVALRPQQEPGLISGIHAEL
  HAEPRGDDWRVSLEDHSSQGTLVNNVRLPRGHRLELSDGDLLTFGPEGPPGTSPSEFYFM
  FQQVRVKPQDFAAITIPRSRGEARVGAGFRPMLPSQGAPQRPLSTFSPAPKATLILNSIG
  SLSKLRPQPLTFSPSWGGPKSLPVPAPPGEMGTTPSAPPQRNRRKSVHRVLAELDDESEP
  PENPPPVLMEPRKKLRVDKAPLTPTGNRRGRPRKYPVSAPMAPPAVGGGEPCAAPCCCLP
  QEETVAWVQCDGCDVWFHVACVGCSIQAAREADFRCPGCRAGIQT

• Sequence length: 345

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Germ cell tumor of testis	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMBRANOUS GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENSORINEURAL HEARING LOSS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sensorineural hearing loss disorder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOXIC EPIDERMAL NECROLYSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TROPICAL SPASTIC PARAPARESIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	GWASDB_DG	19836008		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31141247		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36233194	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24987808, 31746185	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	15059925		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32016966	Stimulate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	24465836, 27596359		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	23860123		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	23860123		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	29042441, 31746185	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	25799151, 29042441	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	17632545		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	21076979, 23860123, 29042441, 31746185		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	25112377, 29042441		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	29632382		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	GWASDB_DG	21900946		★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	33713422	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	24987808	Associate	★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	23860123		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30509085, 31746185		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASDB_DG	24871463		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	GWASDB_DG	19654303, 22899653		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	15059925		★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	GWASCAT_DG	21323541		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	BEFREE	27718532		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	27718532	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	17660530, 20598377		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	GWASDB_DG	23055271		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	23055271	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31141247, 31746185		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	24372652		★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	10777095		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	30509085		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	19503088		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	1645569	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	31141247		★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	GWASCAT_DG	21801394		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	11706063	Inhibit	★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	GWASCAT_DG	21801394		★★☆☆☆ Found in Text Mining + Unknown/Other Associations