Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	6939
Gene name	Transcription factor 15
Gene symbol	TCF15
Synonyms (NCBI Gene)	EC2PARAXISbHLHa40
Chromosome	20
Chromosome location	20p13
Summary	The protein encoded by this gene is found in the nucleus and may be involved in the early transcriptional regulation of patterning of the mesoderm. The encoded basic helix-loop-helix protein requires dimerization with another basic helix-loop-helix protei

Show/Hide all (82)

miRTarBase ID	miRNA	Experiments	Reference
MIRT612166	hsa-miR-8485	HITS-CLIP	23824327
MIRT612165	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612164	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612163	hsa-miR-603	HITS-CLIP	23824327
MIRT612162	hsa-miR-10a-5p	HITS-CLIP	23824327
MIRT439115	hsa-miR-10b-5p	HITS-CLIP	23824327
MIRT612161	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT612160	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612159	hsa-miR-6773-3p	HITS-CLIP	23824327
MIRT612157	hsa-miR-6879-3p	HITS-CLIP	23824327
MIRT612158	hsa-miR-3941	HITS-CLIP	23824327
MIRT612166	hsa-miR-8485	HITS-CLIP	23824327
MIRT612165	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612164	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612163	hsa-miR-603	HITS-CLIP	23824327
MIRT612162	hsa-miR-10a-5p	HITS-CLIP	23824327
MIRT439115	hsa-miR-10b-5p	HITS-CLIP	23824327
MIRT612161	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT612160	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612159	hsa-miR-6773-3p	HITS-CLIP	23824327
MIRT612157	hsa-miR-6879-3p	HITS-CLIP	23824327
MIRT612158	hsa-miR-3941	HITS-CLIP	23824327
MIRT612166	hsa-miR-8485	HITS-CLIP	23824327
MIRT612165	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612164	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612163	hsa-miR-603	HITS-CLIP	23824327
MIRT612162	hsa-miR-10a-5p	HITS-CLIP	23824327
MIRT439115	hsa-miR-10b-5p	HITS-CLIP	23824327
MIRT612161	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT612160	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612159	hsa-miR-6773-3p	HITS-CLIP	23824327
MIRT612157	hsa-miR-6879-3p	HITS-CLIP	23824327
MIRT612158	hsa-miR-3941	HITS-CLIP	23824327
MIRT497011	hsa-miR-4282	PAR-CLIP	22291592
MIRT439115	hsa-miR-10b-5p	3'LIFE	25074381
MIRT439115	hsa-miR-10b-5p	3'LIFE	25074381
MIRT612166	hsa-miR-8485	HITS-CLIP	23824327
MIRT612165	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612164	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612163	hsa-miR-603	HITS-CLIP	23824327
MIRT612162	hsa-miR-10a-5p	HITS-CLIP	23824327
MIRT439115	hsa-miR-10b-5p	HITS-CLIP	23824327
MIRT612161	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT612160	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612159	hsa-miR-6773-3p	HITS-CLIP	23824327
MIRT612157	hsa-miR-6879-3p	HITS-CLIP	23824327
MIRT612158	hsa-miR-3941	HITS-CLIP	23824327
MIRT612166	hsa-miR-8485	HITS-CLIP	23824327
MIRT612165	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612164	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612163	hsa-miR-603	HITS-CLIP	23824327
MIRT612162	hsa-miR-10a-5p	HITS-CLIP	23824327
MIRT439115	hsa-miR-10b-5p	HITS-CLIP	23824327
MIRT612161	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT612160	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612159	hsa-miR-6773-3p	HITS-CLIP	23824327
MIRT612157	hsa-miR-6879-3p	HITS-CLIP	23824327
MIRT612158	hsa-miR-3941	HITS-CLIP	23824327
MIRT612166	hsa-miR-8485	HITS-CLIP	23824327
MIRT612165	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT612164	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT612163	hsa-miR-603	HITS-CLIP	23824327
MIRT612162	hsa-miR-10a-5p	HITS-CLIP	23824327
MIRT439115	hsa-miR-10b-5p	HITS-CLIP	23824327
MIRT612161	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT612160	hsa-miR-339-5p	HITS-CLIP	23824327
MIRT612159	hsa-miR-6773-3p	HITS-CLIP	23824327
MIRT612157	hsa-miR-6879-3p	HITS-CLIP	23824327
MIRT612158	hsa-miR-3941	HITS-CLIP	23824327
MIRT497011	hsa-miR-4282	PAR-CLIP	22291592
MIRT2124782	hsa-miR-1237	CLIP-seq
MIRT2124783	hsa-miR-1248	CLIP-seq
MIRT2124784	hsa-miR-342-3p	CLIP-seq
MIRT2124785	hsa-miR-377	CLIP-seq
MIRT2124786	hsa-miR-3925-3p	CLIP-seq
MIRT2124787	hsa-miR-4645-5p	CLIP-seq
MIRT2124788	hsa-miR-4673	CLIP-seq
MIRT2124789	hsa-miR-4685-5p	CLIP-seq
MIRT2124790	hsa-miR-4768-5p	CLIP-seq
MIRT2124791	hsa-miR-515-5p	CLIP-seq
MIRT2124792	hsa-miR-766	CLIP-seq
MIRT2124784	hsa-miR-342-3p	CLIP-seq

Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISS
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001756	Process	Somitogenesis	IEA
GO:0003016	Process	Respiratory system process	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	8041747, 8825648
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	8825648
GO:0007498	Process	Mesoderm development	TAS	8041747
GO:0007517	Process	Muscle organ development	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0019827	Process	Stem cell population maintenance	IEA
GO:0019827	Process	Stem cell population maintenance	ISS
GO:0030154	Process	Cell differentiation	IEA
GO:0032502	Process	Developmental process	IBA
GO:0036342	Process	Post-anal tail morphogenesis	IEA
GO:0043425	Function	BHLH transcription factor binding	IEA
GO:0043583	Process	Ear development	IEA
GO:0045198	Process	Establishment of epithelial cell apical/basal polarity	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048339	Process	Paraxial mesoderm development	IEA
GO:0048644	Process	Muscle organ morphogenesis	IEA
GO:0048705	Process	Skeletal system morphogenesis	IEA
GO:0050884	Process	Neuromuscular process controlling posture	IEA
GO:0060231	Process	Mesenchymal to epithelial transition	IEA
GO:0070888	Function	E-box binding	IEA
GO:0070888	Function	E-box binding	ISS
GO:0090575	Component	RNA polymerase II transcription regulator complex	IEA
GO:1902037	Process	Negative regulation of hematopoietic stem cell differentiation	IEA
GO:1902037	Process	Negative regulation of hematopoietic stem cell differentiation	ISS
GO:1903053	Process	Regulation of extracellular matrix organization	IEA
GO:2000738	Process	Positive regulation of stem cell differentiation	IEA
GO:2000738	Process	Positive regulation of stem cell differentiation	ISS

MIM	HGNC	e!Ensembl
601010	11627	ENSG00000125878

Q12870

Protein name

Transcription factor 15 (TCF-15) (Class A basic helix-loop-helix protein 40) (bHLHa40) (Paraxis) (Protein bHLH-EC2)

Protein function

Early transcription factor that plays a key role in somitogenesis, paraxial mesoderm development and regulation of stem cell pluripotency. Essential for the mesenchymal to epithelial transition associated with somite formation. Required for somi

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	73 → 125	Helix-loop-helix DNA-binding domain	Domain

Sequence

MAFALLRPVGAHVLYPDVRLLSEDEENRSESDASDQSFGCCEGPEAARRGPGPGGGRRAG
GGGGAGPVVVVRQRQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETVRLASSY
IAHLANVLLLGDSADDGQPCFRAAGSAKGAVPAAADGGRQPRSICTFCLSNQRKGGGRRD
LGGSCLKVRGVAPLRGPRR

Sequence length

199

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arteriosclerosis	Arteriosclerosis	BEFREE	29301788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29301788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34526059	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	26428460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★★★★★ ★☆☆☆☆ Found in Text Mining only

TCF15 (transcription factor 15)