ZEB1 (zinc finger E-box binding homeobox 1)

Gene

• Entrez ID: 6935
• Gene name: Zinc finger E-box binding homeobox 1
• Gene symbol: ZEB1
• Synonyms (NCBI Gene): AREB6, BZP, DELTAEF1, FECD6, NIL2A, PPCD3, TCF8, ZFHEP, ZFHX1A
• Chromosome: 10
• Chromosome location: 10p11.22
• Summary: This gene encodes a zinc finger transcription factor. The encoded protein likely plays a role in transcriptional repression of interleukin 2. Mutations in this gene have been associated with posterior polymorphous corneal dystrophy-3 and late-onset Fuchs

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs766305306	->G	Pathogenic	Coding sequence variant, frameshift variant
rs1057518956	C>T	Pathogenic	Stop gained, coding sequence variant
rs1554930679	CAAT>-	Pathogenic	Frameshift variant, coding sequence variant
rs1592090713	G>T	Pathogenic	Stop gained, coding sequence variant
rs1592143384	TG>-	Pathogenic	Frameshift variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002480	hsa-miR-200a-3p	qRT-PCR, Western blot	19703993
MIRT002480	hsa-miR-200a-3p	qRT-PCR, Luciferase reporter assay, Western blot	18381893
MIRT002286	hsa-miR-200c-3p	qRT-PCR, Luciferase reporter assay, Western blot	18381893
MIRT002480	hsa-miR-200a-3p	Review	19574400
MIRT002286	hsa-miR-200c-3p	Review	19574400
MIRT002483	hsa-miR-200b-3p	Review	19574400
MIRT000317	hsa-miR-141-3p	Luciferase reporter assay	19854497
MIRT002480	hsa-miR-200a-3p	Luciferase reporter assay	18829540
MIRT002480	hsa-miR-200a-3p	Luciferase reporter assay	19854497
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay	18829540
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay	19839049
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay	19854497
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay	19839049
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay	19854497
MIRT001743	hsa-miR-429	Luciferase reporter assay	18829540
MIRT001743	hsa-miR-429	Luciferase reporter assay	19854497
MIRT002480	hsa-miR-200a-3p	qRT-PCR	19854497
MIRT002483	hsa-miR-200b-3p	qRT-PCR	19854497
MIRT001743	hsa-miR-429	intrarenal expression	19910931
MIRT002286	hsa-miR-200c-3p	immunoblot, Luciferase reporter assay, qRT-PCR	20049172
MIRT001743	hsa-miR-429	Review	20130964
MIRT002480	hsa-miR-200a-3p	Luciferase reporter assay, qRT-PCR	19854497
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR	19854497
MIRT002286	hsa-miR-200c-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	18483486
MIRT002286	hsa-miR-200c-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	18483486
MIRT002286	hsa-miR-200c-3p	qRT-PCR	19502803
MIRT002480	hsa-miR-200a-3p	Luciferase reporter assay, qRT-PCR	18411277
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR	18411277
MIRT001743	hsa-miR-429	Luciferase reporter assay, qRT-PCR	18411277
MIRT000317	hsa-miR-141-3p	Luciferase reporter assay, qRT-PCR	18411277
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay, qRT-PCR	18411277
MIRT002480	hsa-miR-200a-3p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002480	hsa-miR-200a-3p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002480	hsa-miR-200a-3p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002478	hsa-miR-205-5p	Luciferase reporter assay, Microarray, Western blot	18376396
MIRT002286	hsa-miR-200c-3p	Immunohistochemistry, qRT-PCR	21224848
MIRT002286	hsa-miR-200c-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21294122
MIRT002480	hsa-miR-200a-3p	Luciferase reporter assay, qRT-PCR, Western blot	21049046
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR, Western blot	21049046
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21049046
MIRT002480	hsa-miR-200a-3p	Immunohistochemistry, qRT-PCR	21125666
MIRT002483	hsa-miR-200b-3p	Immunohistochemistry, qRT-PCR	21125666
MIRT002286	hsa-miR-200c-3p	Immunohistochemistry, qRT-PCR	21125666
MIRT002480	hsa-miR-200a-3p	qRT-PCR, Western blot	21389093
MIRT002483	hsa-miR-200b-3p	qRT-PCR, Western blot	21389093
MIRT002286	hsa-miR-200c-3p	qRT-PCR, Western blot	21389093
MIRT002483	hsa-miR-200b-3p	qRT-PCR, Western blot	21874049
MIRT002480	hsa-miR-200a-3p	qRT-PCR, Western blot	21874049
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay, Western blot	21867514
MIRT002480	hsa-miR-200a-3p	Immunohistochemistry, qRT-PCR	21125666
MIRT002483	hsa-miR-200b-3p	Immunohistochemistry, qRT-PCR	21125666
MIRT002286	hsa-miR-200c-3p	Immunohistochemistry, qRT-PCR	21125666
MIRT002480	hsa-miR-200a-3p	qRT-PCR, Western blot	21389093
MIRT002483	hsa-miR-200b-3p	qRT-PCR, Western blot	21389093
MIRT002286	hsa-miR-200c-3p	qRT-PCR, Western blot	21389093
MIRT002483	hsa-miR-200b-3p	qRT-PCR, Western blot	21874049
MIRT002480	hsa-miR-200a-3p	qRT-PCR, Western blot	21874049
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay, Western blot	21867514
MIRT002286	hsa-miR-200c-3p	GFP reporter assay, qRT-PCR	16929162
MIRT002480	hsa-miR-200a-3p	Immunohistochemistry, qRT-PCR	21125666
MIRT002483	hsa-miR-200b-3p	Immunohistochemistry, qRT-PCR	21125666
MIRT002286	hsa-miR-200c-3p	Immunohistochemistry, qRT-PCR	21125666
MIRT002480	hsa-miR-200a-3p	qRT-PCR, Western blot	21389093
MIRT002483	hsa-miR-200b-3p	qRT-PCR, Western blot	21389093
MIRT002286	hsa-miR-200c-3p	qRT-PCR, Western blot	21389093
MIRT002483	hsa-miR-200b-3p	qRT-PCR, Western blot	21874049
MIRT002480	hsa-miR-200a-3p	qRT-PCR, Western blot	21874049
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay, Western blot	21867514
MIRT002286	hsa-miR-200c-3p	GFP reporter assay, qRT-PCR	16929162
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay, Western blot	22569286
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay, qRT-PCR, Western blot	22407310
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay, qRT-PCR, Western blot	22407310
MIRT006984	hsa-miR-150-5p	Luciferase reporter assay, qRT-PCR, Western blot	23013135
MIRT007059	hsa-miR-130b-3p	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	22847613
MIRT001743	hsa-miR-429	Reporter assay	18411277
MIRT018433	hsa-miR-335-5p	Microarray	18185580
MIRT002480	hsa-miR-200a-3p	Reporter assay	18411277
MIRT002480	hsa-miR-200a-3p	Reporter assay	18381893
MIRT002286	hsa-miR-200c-3p	Western blot	20049172
MIRT002286	hsa-miR-200c-3p	qRT-PCR;Other	19502803
MIRT002286	hsa-miR-200c-3p	Reporter assay	18381893
MIRT000317	hsa-miR-141-3p	qRT-PCR;Other	19502803
MIRT002483	hsa-miR-200b-3p	Reporter assay	18411277
MIRT002478	hsa-miR-205-5p	qRT-PCR;Other	19502803
MIRT002286	hsa-miR-200c-3p	CLASH	23622248
MIRT002483	hsa-miR-200b-3p	qRT-PCR	22294131
MIRT002483	hsa-miR-200b-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	22247255
MIRT002286	hsa-miR-200c-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	22247255
MIRT001743	hsa-miR-429	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	22247255
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay, qRT-PCR, Western blot	22735571
MIRT053160	hsa-miR-101-3p	Immunofluorescence, Luciferase reporter assay, Western blot	24677166
MIRT053244	hsa-miR-23b-3p	Luciferase reporter assay, Western blot	23844063
MIRT002286	hsa-miR-200c-3p	In situ hybridization, qRT-PCR, Western blot	22012804
MIRT000317	hsa-miR-141-3p	In situ hybridization, qRT-PCR, Western blot	22012804
MIRT053387	hsa-miR-591	Luciferase reporter assay, Western blot	23807165
MIRT053387	hsa-miR-591	Luciferase reporter assay, Western blot	23807165
MIRT053407	hsa-miR-629-5p	Microarray	23807165
MIRT053387	hsa-miR-591	Microarray	23807165
MIRT053444	hsa-miR-203a-3p	Microarray	23807165
MIRT002286	hsa-miR-200c-3p	Microarray	23807165
MIRT053515	hsa-miR-494-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23105110
MIRT053516	hsa-miR-539-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23105110
MIRT002480	hsa-miR-200a-3p	Immunofluorescence, Immunohistochemistry, In situ hybridization, qRT-PCR, Western blot	23381389
MIRT002478	hsa-miR-205-5p	Western blot	22555458
MIRT002286	hsa-miR-200c-3p	Immunohistochemistry, Luciferase reporter assay, Microarray, QRTPCR	23497265
MIRT002483	hsa-miR-200b-3p	Immunohistochemistry, Microarray, qRT-PCR, Western blot	25411357
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay, qRT-PCR, Western blot	25502084
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay, qRT-PCR, Western blot	25502084
MIRT000317	hsa-miR-141-3p	Luciferase reporter assay, qRT-PCR, Western blot	25502084
MIRT000317	hsa-miR-141-3p	Luciferase reporter assay, qRT-PCR, Western blot	25502084
MIRT054485	hsa-miR-655-3p	Luciferase reporter assay/Western blot, qRT-PCR	23690952
MIRT054485	hsa-miR-655-3p	Luciferase reporter assay/Western blot, qRT-PCR	23690952
MIRT054560	hsa-miR-1236-3p	Luciferase reporter assay, qRT-PCR, Western blot	24573236
MIRT054560	hsa-miR-1236-3p	Luciferase reporter assay, qRT-PCR, Western blot	24573236
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24615544
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24615544
MIRT054653	hsa-miR-183-5p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	24277930
MIRT054654	hsa-miR-96-5p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	24277930
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay	23318420
MIRT002286	hsa-miR-200c-3p	Luciferase reporter assay	23318420
MIRT002286	hsa-miR-200c-3p	qRT-PCR, Western blot	23754305
MIRT002478	hsa-miR-205-5p	ChIP-seq, LacZ reporter assay	23474752
MIRT002478	hsa-miR-205-5p	ChIP-seq, LacZ reporter assay	23474752
MIRT002478	hsa-miR-205-5p	ChIP-seq, LacZ reporter assay	23474752
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR, Western blot	23408168
MIRT002286	hsa-miR-200c-3p	ChIP-seq, Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	23765923
MIRT002286	hsa-miR-200c-3p	ChIP-seq, Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	23765923
MIRT002286	hsa-miR-200c-3p	ChIP-seq, Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	23765923
MIRT006984	hsa-miR-150-5p	ChIP-seq, Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	23765923
MIRT006984	hsa-miR-150-5p	ChIP-seq, Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	23765923
MIRT002286	hsa-miR-200c-3p	Flow, qRT-PCR, Western blot	23869586
MIRT002480	hsa-miR-200a-3p	qRT-PCR, Western blot	24127332
MIRT002480	hsa-miR-200a-3p	qRT-PCR, Western blot	24127332
MIRT002286	hsa-miR-200c-3p	qRT-PCR, Western blot	24127332
MIRT437940	hsa-miR-142-5p	qRT-PCR, Luciferase reporter assay	23342264
MIRT437940	hsa-miR-142-5p	qRT-PCR, Luciferase reporter assay	23342264
MIRT002286	hsa-miR-200c-3p	ChIP-seq, Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	23765923
MIRT002286	hsa-miR-200c-3p	ChIP-seq, Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	23765923
MIRT002286	hsa-miR-200c-3p	ChIP-seq, Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	23765923
MIRT006984	hsa-miR-150-5p	ChIP-seq, Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	23765923
MIRT006984	hsa-miR-150-5p	ChIP-seq, Flow, Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	23765923
MIRT002286	hsa-miR-200c-3p	Flow, qRT-PCR, Western blot	23869586
MIRT002480	hsa-miR-200a-3p	qRT-PCR, Western blot	24127332
MIRT002480	hsa-miR-200a-3p	qRT-PCR, Western blot	24127332
MIRT002286	hsa-miR-200c-3p	qRT-PCR, Western blot	24127332
MIRT437940	hsa-miR-142-5p	qRT-PCR, Luciferase reporter assay	23342264
MIRT437940	hsa-miR-142-5p	qRT-PCR, Luciferase reporter assay	23342264
MIRT607026	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT607025	hsa-miR-6818-5p	HITS-CLIP	24906430
MIRT607024	hsa-miR-147a	HITS-CLIP	24906430
MIRT607023	hsa-miR-2113	HITS-CLIP	24906430
MIRT607022	hsa-miR-5010-3p	HITS-CLIP	24906430
MIRT607021	hsa-miR-4455	HITS-CLIP	24906430
MIRT607020	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT607026	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT607025	hsa-miR-6818-5p	HITS-CLIP	24906430
MIRT607024	hsa-miR-147a	HITS-CLIP	24906430
MIRT607023	hsa-miR-2113	HITS-CLIP	24906430
MIRT607022	hsa-miR-5010-3p	HITS-CLIP	24906430
MIRT607021	hsa-miR-4455	HITS-CLIP	24906430
MIRT607020	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT002478	hsa-miR-205-5p	HITS-CLIP	22473208
MIRT002478	hsa-miR-205-5p	HITS-CLIP	22473208
MIRT731591	hsa-miR-133a-3p	Luciferase reporter assay	26902265
MIRT731591	hsa-miR-133a-3p	Luciferase reporter assay	26902265
MIRT000317	hsa-miR-141-3p	Luciferase reporter assay, qRT-PCR, Western blot	26160158
MIRT731796	hsa-miR-144-3p	Luciferase reporter assay, qRT-PCR, Western blot	27785072
MIRT731796	hsa-miR-144-3p	Luciferase reporter assay, qRT-PCR, Western blot	27785072
MIRT002483	hsa-miR-200b-3p	qRT-PCR, Western blot	28028835
MIRT001743	hsa-miR-429	Luciferase reporter assay, qRT-PCR, Western blot	26472725
MIRT001743	hsa-miR-429	Luciferase reporter assay, qRT-PCR, Western blot	26472725
MIRT002483	hsa-miR-200b-3p	Western blot	27373709
MIRT732321	hsa-miR-590-3p	Luciferase reporter assay, qRT-PCR, Western blot	26556542
MIRT732321	hsa-miR-590-3p	Luciferase reporter assay, qRT-PCR, Western blot	26556542
MIRT002478	hsa-miR-205-5p	Luciferase reporter assay, qRT-PCR, Western blot	27082508
MIRT002478	hsa-miR-205-5p	Luciferase reporter assay, qRT-PCR, Western blot	27082508
MIRT053160	hsa-miR-101-3p	Microarray	28416776
MIRT053160	hsa-miR-101-3p	Microarray	28416776
MIRT053160	hsa-miR-101-3p	Microarray	28416776
MIRT002286	hsa-miR-200c-3p	qRT-PCR, Western blot	27930974
MIRT002286	hsa-miR-200c-3p	qRT-PCR, Western blot	27930974
MIRT002286	hsa-miR-200c-3p	qRT-PCR, Western blot	27930974
MIRT002286	hsa-miR-200c-3p	qRT-PCR, Western blot	27930974
MIRT053160	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR, Western blot	28109909
MIRT002286	hsa-miR-200c-3p	Immunofluorescence, Immunohistochemistry, Immunoprecipitaion, qRT-PCR, Western blot	28334634
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR, Western blot	27307751
MIRT002483	hsa-miR-200b-3p	Luciferase reporter assay, qRT-PCR, Western blot	27307751
MIRT053160	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR, Western blot	27429852
MIRT607024	hsa-miR-147a	HITS-CLIP	27418678
MIRT607024	hsa-miR-147a	HITS-CLIP	27418678
MIRT607024	hsa-miR-147a	HITS-CLIP	27418678
MIRT607023	hsa-miR-2113	HITS-CLIP	27418678
MIRT607023	hsa-miR-2113	HITS-CLIP	27418678
MIRT607023	hsa-miR-2113	HITS-CLIP	27418678
MIRT607021	hsa-miR-4455	HITS-CLIP	27418678
MIRT607021	hsa-miR-4455	HITS-CLIP	27418678
MIRT607022	hsa-miR-5010-3p	HITS-CLIP	27418678
MIRT607022	hsa-miR-5010-3p	HITS-CLIP	27418678
MIRT607022	hsa-miR-5010-3p	HITS-CLIP	27418678
MIRT607020	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT607020	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT607020	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT607025	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT607025	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT607025	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT607026	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT607026	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT607026	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT733126	hsa-miR-34a-3p	Microarray, qRT-PCR, Western blotting	34102608
MIRT733126	hsa-miR-34a-3p	Microarray, qRT-PCR, Western blotting	34102608
MIRT054485	hsa-miR-655-3p	Immunofluorescence, Immunohistochemistry (IHC), Luciferase reporter assay	33902589
MIRT003137	hsa-miR-200c-3p	Immunocytochemistry (ICC), Western blotting	33045679
MIRT003141	hsa-miR-200a-3p	qRT-PCR	31734859
MIRT734548	hsa-miR-96-3p	Immunohistochemistry (IHC), RNA-seq	33318051
MIRT734647	hsa-miR-199b-5p	Luciferase reporter assay, qRT-PCR	31705138
MIRT003141	hsa-miR-200a-3p	qRT-PCR, ELISA	32691634
MIRT735876	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, in vivo gain/loss-of-function experiments	32641995
MIRT735876	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, in vivo gain/loss-of-function experiments	32641995
MIRT735876	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, in vivo gain/loss-of-function experiments	32641995
MIRT735876	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, in vivo gain/loss-of-function experiments	32641995
MIRT735876	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, in vivo gain/loss-of-function experiments	32641995
MIRT735876	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, in vivo gain/loss-of-function experiments	32641995
MIRT735876	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, in vivo gain/loss-of-function experiments	32641995
MIRT735876	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, in vivo gain/loss-of-function experiments	32641995
MIRT735876	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, in vivo gain/loss-of-function experiments	32641995
MIRT735876	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, in vivo gain/loss-of-function experiments	32641995
MIRT736295	hsa-miR-326	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	33913391
MIRT003139	hsa-miR-200b-3p	Western blotting, qRT-PCR	34018840
MIRT735876	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, In situ hybridization	32641995
MIRT001743	hsa-miR-429	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR, Flow cytometry	32306838
MIRT737471	hsa-miR-639	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR	31843451
MIRT755678	hsa-miR-142-3p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunoprecipitaion (IP), Immunohistochemistry (IHC), in vitro cullelar assays, Flow cytometry	37403081
MIRT006984	hsa-miR-150-5p	Luciferase reporter assay, qRT-PCR	35402187
MIRT002483	hsa-miR-200b-3p	Western blotting, qRT-PCR	37681509
MIRT1509239	hsa-miR-101	CLIP-seq
MIRT1509240	hsa-miR-144	CLIP-seq
MIRT1509241	hsa-miR-3617	CLIP-seq
MIRT1509242	hsa-miR-4464	CLIP-seq
MIRT1509243	hsa-miR-4684-3p	CLIP-seq
MIRT1509244	hsa-miR-4709-3p	CLIP-seq
MIRT1509245	hsa-miR-4748	CLIP-seq
MIRT1509246	hsa-miR-4755-3p	CLIP-seq
MIRT1509247	hsa-miR-641	CLIP-seq
MIRT1509248	hsa-miR-297	CLIP-seq
MIRT1509249	hsa-miR-300	CLIP-seq
MIRT1509250	hsa-miR-381	CLIP-seq
MIRT1509251	hsa-miR-3929	CLIP-seq
MIRT1509252	hsa-miR-4419b	CLIP-seq
MIRT1509253	hsa-miR-4478	CLIP-seq
MIRT1509254	hsa-miR-584	CLIP-seq
MIRT1509249	hsa-miR-300	CLIP-seq
MIRT2153390	hsa-miR-3662	CLIP-seq
MIRT1509250	hsa-miR-381	CLIP-seq
MIRT2153391	hsa-miR-4282	CLIP-seq
MIRT2373668	hsa-miR-105	CLIP-seq
MIRT2373669	hsa-miR-147	CLIP-seq
MIRT1509249	hsa-miR-300	CLIP-seq
MIRT2373670	hsa-miR-3065-5p	CLIP-seq
MIRT1509250	hsa-miR-381	CLIP-seq
MIRT2373671	hsa-miR-4803	CLIP-seq
MIRT2373672	hsa-miR-599	CLIP-seq
MIRT2695631	hsa-miR-141	CLIP-seq
MIRT2695632	hsa-miR-200a	CLIP-seq
MIRT2695633	hsa-miR-3161	CLIP-seq
MIRT2695634	hsa-miR-3163	CLIP-seq
MIRT2695635	hsa-miR-340	CLIP-seq
MIRT2695636	hsa-miR-3682-3p	CLIP-seq
MIRT2153391	hsa-miR-4282	CLIP-seq
MIRT2695637	hsa-miR-4307	CLIP-seq
MIRT2695638	hsa-miR-448	CLIP-seq
MIRT2695639	hsa-miR-4502	CLIP-seq
MIRT2695640	hsa-miR-4662a-3p	CLIP-seq
MIRT2695641	hsa-miR-4735-5p	CLIP-seq
MIRT2695642	hsa-miR-4762-3p	CLIP-seq
MIRT2695643	hsa-miR-516a-3p	CLIP-seq
MIRT2695644	hsa-miR-577	CLIP-seq
MIRT2695645	hsa-miR-626	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
EP300	Unknown	16804902
ERG	Unknown	21747944
ESR1	Activation	22391641
GATA3	Activation	20731704
KAT2B	Repression	22384255
LMO2	Repression	20731704
PCGF2	Repression	23474752
SALL4	Activation	23954296

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	23765923, 23814079
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	1840704
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	23765923, 23814079
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	8138542
GO:0005515	Function	Protein binding	IPI	20418909
GO:0005634	Component	Nucleus	IDA	20418909, 23814079, 25190660
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	8138542
GO:0007389	Process	Pattern specification process	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007417	Process	Central nervous system development	IBA
GO:0007417	Process	Central nervous system development	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	TAS	8138542
GO:0008283	Process	Cell population proliferation	IEA
GO:0010464	Process	Regulation of mesenchymal cell proliferation	IEA
GO:0010839	Process	Negative regulation of keratinocyte proliferation	IEA
GO:0017015	Process	Regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030857	Process	Negative regulation of epithelial cell differentiation	IEA
GO:0033081	Process	Regulation of T cell differentiation in thymus	IEA
GO:0043616	Process	Keratinocyte proliferation	IEA
GO:0045602	Process	Negative regulation of endothelial cell differentiation	IMP	23765923
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0045666	Process	Positive regulation of neuron differentiation	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	20418909
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	12937339
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048513	Process	Animal organ development	IEA
GO:0048596	Process	Embryonic camera-type eye morphogenesis	IEA
GO:0048598	Process	Embryonic morphogenesis	IEA
GO:0048704	Process	Embryonic skeletal system morphogenesis	IEA
GO:0048752	Process	Semicircular canal morphogenesis	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0051150	Process	Regulation of smooth muscle cell differentiation	IEA
GO:0051216	Process	Cartilage development	IEA
GO:0070888	Function	E-box binding	IEA
GO:0070888	Function	E-box binding	ISS
GO:0071230	Process	Cellular response to amino acid stimulus	IEA
GO:0090103	Process	Cochlea morphogenesis	IEA

Other IDs

• MIM: 189909
• HGNC: 11642
• e!Ensembl: ENSG00000148516

Protein

• UniProt ID: P37275
• Protein name: Zinc finger E-box-binding homeobox 1 (NIL-2-A zinc finger protein) (Negative regulator of IL2) (Transcription factor 8) (TCF-8)
• Protein function: Acts as a transcriptional repressor. Inhibits interleukin-2 (IL-2) gene expression. Enhances or represses the promoter activity of the ATP1A1 gene depending on the quantity of cDNA and on the cell type. Represses E-cadherin promoter and induces
• PDB: 2E19
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05605	zf-Di19	168 → 224	Drought induced 19 protein (Di19), zinc-binding	Domain
  PF00096	zf-C2H2	240 → 262	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	268 → 289	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	932 → 954	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	960 → 981	Zinc finger, C2H2 type	Domain

• Tissue specificity: TISSUE SPECIFICITY: Colocalizes with SMARCA4/BRG1 in E-cadherin-negative cells from established lines, and stroma of normal colon as well as in de-differentiated epithelial cells at the invasion front of colorectal carcinomas (at protein level). Expressed
• Sequence:

  MADGPRCKRRKQANPRRNNVTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDD
  LPTDQTVLPGRSSEREGNAKNCWEDDRKEGQEILGPEAQADEAGCTVKDDECESDAENEQ
  NHDPNVEEFLQQQDTAVIFPEAPEEDQRQGTPEASGHDENGTPDAFSQLLTCPYCDRGYK
  RFTSLKEHIKYRHEKNEDNFSCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGCNRKF
  KCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLIPVNG
  RPRTGLKTSQCSSPSLSASPGSPTRPQIRQKIENKPLQEQLSVNQIKTEPVDYEFKPIVV
  ASGINCSTPLQNGVFTGGGPLQATSSPQGMVQAVVLPTVGLVSPISINLSDIQNVLKVAV
  DGNVIRQVLENNQANLASKEQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLE
  QPSQLQVVPQNLKKENPVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCPGD
  INALPELKHYDLKQPTQPPPLPAAEAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYY
  ALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNND
  QPQSANANEPQDSTVNLQSPLKMTNSPVLPVGSTTNGSRSSTPSPSPLNLSSSRNTQGYL
  YTAEGAQEEPQVEPLDLSLPKQQGELLERSTITSVYQNSVYSVQEEPLNLSCAKKEPQKD
  SCVTDSEPVVNVIPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQ
  VAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE
  NGMYACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKPY
  QCDKCGKRFSHSGSYSQHMNHRYSYCKREAEERDSTEQEEAGPEILSNEHVGARASPSQG
  DSDERESLTREEDEDSEKEEEEEDKEMEELQEEKECEKPQGDEEEEEEEEEVEEEEVEEA
  ENEGEEAKTEGLMKDDRAESQASSLGQKVGESSEQVSEEKTNEA

• Sequence length: 1124

Pathways

KEGG:

Transcriptional misregulation in cancer
MicroRNAs in cancer
Prostate cancer

Reactome:

Interleukin-4 and Interleukin-13 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Corneal dystrophy	Likely pathogenic; Pathogenic	rs2543968405, rs2543993592, rs766305306	RCV003313267 RCV003313330 RCV000499953	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Corneal dystrophy, Fuchs endothelial, 6	Likely pathogenic; Pathogenic	rs2069829602, rs2543968405, rs779148597, rs2543952522, rs1554797626	RCV001334289 RCV002463373 RCV003152395 RCV003152915 RCV003991031	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Glaucoma	Pathogenic	rs1057518956	RCV000415113	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Posterior polymorphous corneal dystrophy	Likely pathogenic; Pathogenic	rs2139506946, rs1057518956	RCV002466691 RCV000415113	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Posterior polymorphous corneal dystrophy 1	Likely pathogenic	rs2139622959	RCV002272489	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Posterior polymorphous corneal dystrophy 3	Pathogenic; Likely pathogenic	rs1458928910, rs2538531589, rs1592143384, rs2139794959, rs2543770473, rs1554797626	RCV003152396 RCV003152397 RCV000013466 RCV000013467 RCV003447694 RCV003991031	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Visual loss	Pathogenic	rs1057518956	RCV000415113	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL DYSTROPHY, POSTERIOR POLYMORPHOUS, 1	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL DYSTROPHY, POSTERIOR POLYMORPHOUS, 3	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FUCHS ENDOTHELIAL CORNEAL DYSTROPHY	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FUCHS ENDOTHELIAL DYSTROPHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FUCHS' ENDOTHELIAL DYSTROPHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY CORNEAL DYSTROPHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL SUBMUCOSAL FIBROSIS, INCLUDING OF TONGUE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ORAL SUBMUCOUS FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT 1	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYMORPHOUS CORNEAL DYSTROPHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEZARY SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID CANCER, PAPILLARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ZEB1-related disorder	Benign; Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	30178847		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	21878201, 25864110		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	28605329		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16707460, 22481253, 23255418, 24762440, 25880398, 26459797, 29324442, 30718593, 31173403		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	21224848		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	16585218, 18487993		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	22080605		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	30918109	Associate	★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	31570691		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	18467597, 20514018		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	LHGDN	18467597		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	28742278		★☆☆☆☆ Found in Text Mining only
Alport Syndrome	Alport Syndrome	BEFREE	16252232		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	31397928, 31674718		★☆☆☆☆ Found in Text Mining only
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	36736597	Inhibit	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	17486063, 23324130, 28246385		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	BEFREE	28940869		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	22045191, 26609108, 28849150, 29111166, 29120411, 29490942, 30352575, 30791220, 31123345, 31512195		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	24626634		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12509789, 22355377, 25880754	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	35169275	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	24626634		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29352223, 30880686		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	30268789		★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	30280445	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	22906492, 23239884, 23844063, 24306957, 26544536, 28261684, 29467870, 29552157		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	16252232	Associate	★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	25973542	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	25521330		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	25521330	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17997862, 18321996, 18805502, 19308091, 20006705, 20890129, 21224848, 21525039, 23474752, 23584475, 23827675, 24283570, 24615544, 25528765, 25973542, 26062653, 26646320, 26882471, 27036021, 27079864, 27292262, 27507057, 27717206, 27845906, 28063065, 28086235, 28247944, 28281973, 28383555, 28394329, 28423483, 28857253, 28903350, 29084210, 29104620, 29187406, 29288666, 29323713, 29352223, 29510731, 29512767, 29575368, 29596855, 29632713, 30082484, 30273966, 30814639, 30976202, 31064130, 31324807, 31354360, 31639340, 31682640, 31780722, 31799668, 31828042		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	19839049, 21501481		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17486063, 17997862, 18321996, 19604397, 19921427, 20006705, 21224848, 21315410, 21324165, 21525039, 22632166, 23285017, 23318438, 24283570, 24508063, 25155634, 25160502, 25315069, 25733818, 25871474, 25973542, 26181203, 26334100, 26646320, 26823172, 26876920, 27036021, 27809618, 27871329, 28086235, 28247944, 28281973, 28371195, 28423483, 28852133, 29288666, 29368542, 29575368, 29744893, 30273966, 30710426, 31064130, 31467112, 31511359, 31780722, 31799668, 32313093, 32408908, 32488136, 32692442, 33087801, 33303690, 34074001, 34231077, 34446052, 34920184, 35008529, 35246504, 35440541, 35905576, 36100877, 37217832, 37356459, 37372954, 37403081, 37978168, 38139138	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	31880901	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	25174397		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24577090, 29863254, 31467112, 31843451, 31978895, 35034102, 36034202, 37372954	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28830551	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	20213325, 20418909, 22080605, 24013721, 24577090, 30739164		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	25142232	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	29288666	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	18487993, 29060924	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24304617, 26617942, 26695141, 27102441, 27861158, 28488544, 29228420, 29523781, 30840268, 31843451, 33833131, 33865414, 34018840, 34496784, 35277182, 35345355, 35900486, 37138218, 40038747	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31548493	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	21324165	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	21324165	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	22906492, 23239884, 23844063, 24306957, 26544536, 28261684, 29467870, 29552157		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12937339, 19177200, 20452118, 20980099, 22481253, 22850877, 27456471, 27500490, 27694892, 31037155, 31741753, 31807189		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26887977, 39519394	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	28623900	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	22045191, 23918833, 27424525, 29120411, 30352575, 33266052	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27031776, 27297979, 33032610	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26617850, 26864590, 36012449, 38183060	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	23743934, 30739164		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24573236, 24677166, 25090005, 26275944, 26887977, 28646172, 28754469, 28943941, 29038174, 29245917, 30098599, 30481785, 30965236, 31497537, 31695412		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	BEFREE	26515382		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	30655804, 30739164		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	37169340	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Thrombosis	Carotid Artery Thrombosis	BEFREE	28760439		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28760439, 29021761		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29115509, 30253398, 30425516, 31007650, 31092700		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29115509, 30253398, 30425516, 31007650, 31092700		★☆☆☆☆ Found in Text Mining only
Chandler syndrome	Chandler Syndrome	BEFREE	22199242, 23662738		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	24123265, 26479153		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	31978895, 32236578, 38538281	Associate	★☆☆☆☆ Found in Text Mining only
Choledochal Cyst	Choledochal Cyst	BEFREE	26479153		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	27225469		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	31366457		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16203744, 16804902, 22407310, 23174018, 26455323, 26487301, 27150059, 27315462, 29151941, 30588252, 31452805		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	16203744		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	21878201, 26455323, 29426364		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	21878201, 37946148	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16952552, 17029218, 22080605, 22205702, 22212097, 22286765, 22407310, 22735571, 23340304, 26057751, 26387539, 26540342, 27463018, 27965283, 28416756, 28638460, 28837144, 29325758, 29426364, 29511455, 29569786, 30460377, 30794031, 30899394, 30979372, 31063022, 31137914, 31281520, 31366457, 31632515, 31747371		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17486063, 21878201, 22205702, 22212097, 23174018, 23372686, 24498091, 25750173, 26455323, 26823743, 27315462, 27463018, 27533463, 27824159, 28791382, 28967064, 30097457, 31792281, 32094334, 32600257, 32669962, 34081622, 35034102, 35101080, 36510899, 37091904, 38093305, 39307879	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29886791	Stimulate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	24304426		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	25749036		★☆☆☆☆ Found in Text Mining only
Congenital myasthenic syndrome ib	Congenital myasthenic syndrome	Pubtator	33721619	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28743963, 31222939		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective tissue disease	Pubtator	19997581	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30988768, 31550675		★☆☆☆☆ Found in Text Mining only
Corneal Dystrophies Hereditary	Corneal dystrophy	Pubtator	23599324, 36902444	Associate	★☆☆☆☆ Found in Text Mining only
Corneal dystrophy	Corneal Dystrophy	BEFREE	19710953, 23599324, 25190660, 28284480		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Corneal dystrophy	Corneal Dystrophy	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Corneal dystrophy	Corneal Dystrophy	HPO_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Corneal Dystrophy Fuchs Endothelial 6	Corneal dystrophy	Pubtator	23599324	Associate	★☆☆☆☆ Found in Text Mining only
Corneal dystrophy Fuchs' endothelial 1	Corneal dystrophy	Pubtator	23599324	Associate	★☆☆☆☆ Found in Text Mining only
Corneal Dystrophy Posterior Polymorphous 1	Posterior polymorphous corneal dystrophy	Pubtator	15384081, 16252232, 17437275, 17935237, 19432861, 19997581, 20036349, 20567203, 22199242, 23559851, 23599324, 24113819, 24780443, 26508574, 26619383, 26749309, 28654985, 31194824, 31201376, 36613650	Associate	★☆☆☆☆ Found in Text Mining only
Corneal Dystrophy Posterior Polymorphous 3	Posterior polymorphous corneal dystrophy	Pubtator	22199242, 23599324, 25190660, 26508574, 27537263, 29046608, 33946386, 36613650	Associate	★☆☆☆☆ Found in Text Mining only
CORNEAL DYSTROPHY, FUCHS ENDOTHELIAL, 6	Corneal Endothelial Dystrophy	GENOMICS_ENGLAND_DG	16252232		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
CORNEAL DYSTROPHY, FUCHS ENDOTHELIAL, 6	Corneal Endothelial Dystrophy	UNIPROT_DG	20036349, 23599324, 25190660		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
CORNEAL DYSTROPHY, FUCHS ENDOTHELIAL, 6	Corneal Endothelial Dystrophy	CTD_human_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
CORNEAL DYSTROPHY, FUCHS ENDOTHELIAL, 6	Corneal Endothelial Dystrophy	CLINVAR_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
CORNEAL DYSTROPHY, POSTERIOR POLYMORPHOUS, 3 (disorder)	Corneal Dystrophy Posterior Polymorphous	GENOMICS_ENGLAND_DG	16252232, 20036349		★☆☆☆☆ Found in Text Mining only
CORNEAL DYSTROPHY, POSTERIOR POLYMORPHOUS, 3 (disorder)	Corneal Dystrophy Posterior Polymorphous	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
CORNEAL ENDOTHELIAL DYSTROPHY 1, AUTOSOMAL DOMINANT	CORNEAL ENDOTHELIAL DYSTROPHY	BEFREE	16252232, 17437275, 17935237, 19432861, 19997581, 20808945, 22199242, 23559851, 23599324, 26508574, 26619383, 28654985, 28742278, 31201376, 31233731		★☆☆☆☆ Found in Text Mining only
CORNEAL ENDOTHELIAL DYSTROPHY 2	CORNEAL ENDOTHELIAL DYSTROPHY	BEFREE	22199242, 23662738		★☆☆☆☆ Found in Text Mining only
Corneal endothelial dystrophy type 2	Corneal endothelial dystrophy	Pubtator	22199242	Associate	★☆☆☆☆ Found in Text Mining only
Corneal guttata	Corneal guttata	HPO_DG			★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	28487391	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Desmoplastic Small Round Cell Tumor	Desmoplastic small round cell tumor	Pubtator	28415643	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	24304426, 25391656, 26822089		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	24304426, 25391656, 26822089		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	26264186	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	Pubtator	33215445	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	32294702	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29227974, 30549040		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	24390222, 31570691		★☆☆☆☆ Found in Text Mining only
Dysgerminoma	Dysgerminoma	BEFREE	28585395		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	16585218, 18487993, 18622689, 22847613, 23743934, 25892250, 30739164, 31815037		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	CTD_human_DG	18622689		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	18487993, 18622689, 25544793, 33457409, 34948036, 37169340, 37335710	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial Neoplasms	CTD_human_DG	18622689		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	23743934, 26367784	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	BEFREE	28597474, 30506548, 30664209		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	28597474, 32802844	Associate	★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	25521330		★☆☆☆☆ Found in Text Mining only
Epidermolysis bullosa with pyloric atresia	Epidermolysis bullosa	Pubtator	35145202	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	25090005, 26275944, 26887977, 28646172, 28754469		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	25142232		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	29113674, 29771414		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	29771414		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	37124931	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25142232, 25897987, 26617942, 28294486, 36042592	Associate	★☆☆☆☆ Found in Text Mining only
Familial Nonmedullary Thyroid Cancer	Thyroid cancer	CTD_human_DG	28030816		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	LHGDN	16087177		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	25417901, 28407375, 31712061		★☆☆☆☆ Found in Text Mining only
Fish-Eye Disease	Fish-Eye Disease	BEFREE	22234156		★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	20036349		★☆☆☆☆ Found in Text Mining only
Fuchs endothelial corneal dystrophy	Fuchs Endothelial Dystrophy	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	18172091, 20036349, 23599324, 23662738, 24348007, 25190660, 26302187, 26622166, 28608272, 29799290, 31705138		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	ORPHANET_DG	20036349		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	GENOMICS_ENGLAND_DG	20036349		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	20036349, 23110055, 23599324, 24348007, 25190660, 25548511, 26302187, 26622166, 27121161, 29294389, 31705138	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
gallbladder neoplasm	Neoplasm of gallbladder	LHGDN	19116147		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	19116147, 34913073	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Glioblastoma	Glioblastoma	BEFREE	19280063, 22652173, 25275602, 25521330, 25833697, 27667169, 28246407, 28945795, 29345288, 29467947, 29476046, 29901177, 29903919, 30158599, 30167084, 30909436, 31113618		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19280063, 23482671, 25521330, 25592037, 25833697, 27852622, 28945795, 29476046, 29903919, 30158599, 32179921, 33245508	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19280063, 22652173, 25275602, 25521330, 25833697, 27667169, 28928831, 28945795, 29345288, 29467947, 29476046, 29901177, 29903919, 30158599, 30167084, 30909436, 31113618		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24602166, 27041571, 27568035, 27589728, 27608897, 28246407, 28349823, 28388562, 28886531, 28945795, 30008863, 30107990, 31558707, 31571911		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25521330, 27568035, 27589728, 27608897, 28349823, 28445977, 28945795, 29863254	Associate	★☆☆☆☆ Found in Text Mining only
Gliosarcoma	Gliosarcoma	Pubtator	30451796, 37169340	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatous Slack Skin	Granulomatous Slack Skin	CTD_human_DG	26192916		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	36982993	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28743963, 31222939		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	29475118		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	22080605		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	31439646		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	27435064		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	32345067	Associate	★☆☆☆☆ Found in Text Mining only
Hypoplasia of corpus callosum	Hypoplasia Of Corpus Callosum	BEFREE	24780443		★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	Pubtator	21421232	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	Pubtator	22391641	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23050024, 25521330, 30954471, 31263103, 32640738, 38183060	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25592037, 35246504	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	25358403, 27586205	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	27586205		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	23771907		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	22080605		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	29288666		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29590624		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	23599324		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	23599324, 36883248	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	27871329	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	30854928		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	22685266	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	16585218, 22685266		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36812496	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	31055699		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	20731704		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	29980789		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20625840, 21584833, 24768205, 25065598, 25909223, 26069248, 26073087, 26514226, 27702662, 28383782, 28416756, 28488544, 28543721, 29113674, 29228420, 29523781, 29778425, 30092578, 30482773, 30615851, 30664206, 30778199, 31387985, 31401394, 31543517, 31548493, 31570854, 31712061, 31818638, 31843451		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	25065598		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	30050057	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19177200, 20452118, 20980099, 25120788, 25837484, 26191328, 31244281, 33825780, 34020945	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	27007150, 28337746, 30867319		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	28438897		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	28438897		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	16224536, 28438897		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	28438897		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25120788, 25544793, 33761659, 36042592, 37076857, 37077062	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25142232, 26617850, 26617942, 29771411, 30829316, 37335710	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	35905576	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	30178847		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	24013721		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	CTD_human_DG	26192916		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	27422033		★☆☆☆☆ Found in Text Mining only
Lynch Syndrome	Lynch Syndrome	BEFREE	22080605		★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development, Group II	Malformation of cortical development	BEFREE	31116980		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	24013721, 30251692		★☆☆☆☆ Found in Text Mining only
Malignant Meningioma	Malignant Meningioma	BEFREE	30849635		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	30609805		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	25521330, 28246407		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17997862, 18199550, 18321996, 18805502, 19308091, 20006705, 20890129, 21224848, 21525039, 23474752, 23584475, 23827675, 24283570, 24615544, 25528765, 25973542, 26062653, 26646320, 26882471, 27036021, 27079864, 27292262, 27507057, 27717206, 27845906, 28063065, 28086235, 28247944, 28281973, 28383555, 28394329, 28423483, 28857253, 28903350, 29084210, 29104620, 29187406, 29288666, 29323713, 29352223, 29510731, 29512767, 29575368, 29596855, 29632713, 29744893, 30082484, 30273966, 30814639, 30976202, 31064130, 31324807, 31354360, 31639340, 31682640, 31780722, 31799668, 31828042		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	19839049, 21501481		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	22847613, 25892250, 31815037		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	29771414		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	19116147		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	28416756		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31807189, 31843451		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12937339, 19177200, 20452118, 20980099, 22481253, 22632166, 22850877, 27456471, 27500490, 27694892, 31037155, 31741753, 31807189		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	18622689		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24573236, 24677166, 26887977, 29038174, 30098599, 30481785, 30965236, 31497537, 31695412		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19935649, 22147512, 26077342, 26498682, 26609108, 26898939, 26940738, 27878247, 28212565, 28337746, 28416756, 29098031, 29490942, 29615456, 29667486, 29719293, 29970904, 30194893, 30487699, 31711924		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18381457, 18497080, 21804603, 22949650, 23024790, 25160502, 25455932, 26717907, 27017949, 27270433, 27818287, 28133913, 28274892, 28830551, 28861151, 29271397, 29754422, 30008858, 30065348, 30161276, 30483800, 30717752, 30880686, 31534537, 31759982		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21717425, 22095522, 22466758, 25502084, 25986864, 27082508, 28416756, 29039488, 29138864, 29215918, 29302045, 29771411, 30015861, 30674889, 31019894, 31142662, 31352238, 31440062, 31793989		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	24577090, 27683118, 31257462, 31846430		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	25890268, 26036631		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	22906492, 23239884, 23844063, 24306957, 26544536, 28261684, 29467870, 29552157		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15674322, 17486063, 18199550, 18622689, 19116147, 19208835, 19706487, 19921427, 20668090, 21224848, 21874049, 21890822, 22847613, 24009065, 24037528, 24585249, 25032749, 25160502, 25455932, 25808945, 26057751, 26073087, 26387539, 26514226, 26876920, 27500490, 27630154, 27694892, 27965283, 28109909, 28246385, 28415643, 28638460, 28700115, 28783176, 28870549, 28903350, 28943941, 29038174, 29051323, 29226522, 29254997, 29271397, 29345288, 29490942, 29552157, 29615456, 29754422, 29778540, 30008863, 30026848, 30061949, 30283733, 30444080, 30481785, 30482773, 30985990, 31037155, 31248382, 31366457, 31492002, 31734859, 31752242, 31807189, 31838790, 31843451		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29115509, 30253398, 30425516, 31007650, 31092700		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16203744, 16804902, 22407310, 23174018, 24454732, 26455323, 26487301, 27150059, 27315462, 29151941, 30588252, 31452805		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	19839049, 21501481		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17486063, 18321996		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	19839049, 21501481		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24283570, 26098771, 26181203, 27717206, 28903350, 29608014		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	19839049, 21501481		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	24013721, 30251692		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19208835, 21593765, 24390218, 27170270, 28678785, 29495972, 29959879, 30651872, 31383874		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21593765, 27596438, 31383874, 35029926, 37801083	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	35232428	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	28870549		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	30849635	Associate	★☆☆☆☆ Found in Text Mining only
Meningomyelocele	Meningomyelocele	BEFREE	28735706		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	21983934		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	22086445, 35461395	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	30609805	Stimulate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	27170270		★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	15577676		★☆☆☆☆ Found in Text Mining only
Mixed Tumor, Mullerian	Mixed Tumor, Mullerian	BEFREE	18487993		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	28597474	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	26934322, 32728068	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	25174397		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	20856809		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	32567520	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	37408496	Associate	★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	29038174		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31675172		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myxoid/Round Cell Liposarcoma	Myxoid Liposarcoma	BEFREE	29980789		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	26936585, 30061949, 31760895		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	27020592, 31760895, 37989078	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16203744, 16585218, 16804902, 17391671, 17486063, 18467597, 18483486, 18487993, 19177200, 19208835, 19802011, 19839716, 19935649, 20006705, 20418909, 20452118, 20514018, 21224847, 21224848, 21584833, 22080605, 22205702, 22466758, 22481253, 22892238, 23013135, 23065281, 23340304, 23530113, 23869586, 24013721, 24121493, 24127332, 24306957, 24643400, 24659820, 25058589, 25086746, 25142232, 25150550, 25174397, 25221999, 25348003, 25521330, 25592037, 25989272, 26011542, 26181203, 26387539, 26498682, 26544536, 26728244, 26820701, 27007150, 27422033, 27530323, 27568035, 27608897, 27630154, 27818287, 27965283, 28075045, 28086235, 28261684, 28270621, 28286418, 28294486, 28475002, 28837144, 28870549, 28945795, 29038174, 29039488, 29274277, 29352223, 29511455, 29754422, 29760516, 29778661, 29959879, 29980789, 30008863, 30082484, 30139661, 30209363, 30405106, 30481785, 30487699, 30518749, 30662328, 30718355, 30829316, 30840275, 30846940, 30988768, 31126819, 31163263, 31248382, 31324807, 31388313, 31439646, 31506938, 31638344, 31655611, 31780722, 31815037, 31828042		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30985990		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16707460, 20452118, 20980099, 21643654, 22045191, 23255418, 24318272, 25032749, 26395400, 26789630, 26801503, 27409677, 27500490, 27790864, 28288138, 28843520, 28849018, 29039479, 29320940, 29736210, 30448056, 30693031, 30840275, 31037155, 31719531, 31742752		★☆☆☆☆ Found in Text Mining only
Nonmedullary Thyroid Carcinoma	Nonmedullary thyroid carcinoma	CTD_human_DG	28030816		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	25630869	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	17804704		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	24400868, 26934322, 29958727		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	24400868	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oral Submucous Fibrosis	Oral Submucous Fibrosis	CTD_human_DG	26934322		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	26934322, 29958727	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	34990303	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	20515682, 22213004, 24633485, 24815002, 28075045, 28387915, 28694763, 28714003, 28781686, 28849077, 29494357, 29523223, 29872308, 30265649, 30304565, 30367466, 30453308, 30580326, 30655889, 30846940, 30864726, 31746422		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	28387915	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	29523223, 30453308, 31894343, 33829438	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	24677166		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	25119590	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	18622689		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24573236, 26887977, 29038174, 30098599, 30481785, 30965236, 31497537, 31695412		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18622689, 19854497, 22479527, 23554977, 24677166, 24762435, 25119590, 26887977, 29952249, 30448260, 30965236, 32247610, 34163033, 35794446, 35953860, 37774079	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19935649, 22147512, 26077342, 26498682, 26609108, 26898939, 26940738, 27878247, 28212565, 28337746, 28416756, 29098031, 29490942, 29615456, 29667486, 29719293, 29970904, 30194893, 30487699, 31711924		★☆☆☆☆ Found in Text Mining only
Pancreatic Carcinoma	Pancreatic cancer	Pubtator	30451796	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	27424525, 28064441, 28849150, 29490942		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19584296, 21224848, 21909380, 25409617, 26511091, 26609108, 28212565, 29120411, 30158928, 30318866, 30487699, 31688603, 32484209, 32779876, 35186455	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31584877	Stimulate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	CTD_human_DG	28030816		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	23918833		★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	30268789		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	25630869	Associate	★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	30888602		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	39519394	Associate	★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	29608014		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	25521330		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	38243290	Inhibit	★☆☆☆☆ Found in Text Mining only
Polymorphous corneal dystrophy	Polymorphous corneal dystrophy	BEFREE	16252232, 17437275, 17935237, 19432861, 19997581, 20036349, 21067486, 22199242, 23559851, 23599324, 23807282, 24113819, 24780443, 26508574, 26619383, 28046031, 28414732, 28654985, 28742278, 30851240, 31194824, 31201376, 31233731		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polymorphous corneal dystrophy	Polymorphous corneal dystrophy	ORPHANET_DG	23807282, 25441224		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polymorphous corneal dystrophy	Polymorphous corneal dystrophy	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Posterior polymorphous corneal dystrophy	Polymorphous corneal dystrophy	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	30178847		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	29778661		★☆☆☆☆ Found in Text Mining only
Progressive pseudorheumatoid dysplasia	Progressive Pseudorheumatoid Dysplasia	BEFREE	28742278		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18381457, 18497080, 21804603, 22949650, 23024790, 25455932, 26717907, 27017949, 27270433, 27818287, 28133913, 28274892, 28830551, 28861151, 29271397, 29754422, 30008858, 30065348, 30161276, 30483800, 30717752, 30880686, 31534537, 31545930, 31759982		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	18381457, 28133913		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20729552, 21804603, 22249256, 23024790, 28133913, 28830551, 29028100, 29206234, 29271397, 30065348, 30754655, 30880686, 31918265, 32640738, 34884649, 35682554, 40141159	Associate	★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	26995143		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	25358403, 30050057	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	27586205, 29200203, 30050057, 30755599		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31550675		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29789348, 30886169		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	30472203		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	22213004, 28678785		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	27402864	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	30144413		★☆☆☆☆ Found in Text Mining only
Schnyder crystalline corneal dystrophy	Schnyder crystalline corneal dystrophy	BEFREE	30950897		★☆☆☆☆ Found in Text Mining only
Sebaceous Adenocarcinoma	Sebaceous Adenocarcinoma	BEFREE	29760516		★☆☆☆☆ Found in Text Mining only
Sebaceous Gland Neoplasms	Sebaceous gland neoplasms	Pubtator	29760516	Associate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	30097457		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	CTD_human_DG	26551670		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sezary Syndrome	Sezary syndrome	Pubtator	26551670, 27039262, 30518749, 32567520	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sezary Syndrome	Sezary Syndrome	BEFREE	30518749		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	31072267	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	22632166		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	22632166	Associate	★☆☆☆☆ Found in Text Mining only
Spherocytosis Type 1	Spherocytosis	Pubtator	37922232	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	25367287		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23013135, 25142232, 26334393, 28294486, 28408353, 29329360, 29416674, 29423052, 30444080, 30824187, 31126819, 31207321, 31401160, 31638344		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19147758, 25640197, 29150940, 32728068, 33761659, 34257531, 36034202, 36248798, 37076857, 37077062	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	23065281, 28415044		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	28243114		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	30881495		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	20416468		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	26043676, 27871329		★☆☆☆☆ Found in Text Mining only
Stickler syndrome type 3	Stickler syndrome	Pubtator	16252232	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21717425, 22095522, 22466758, 25502084, 25986864, 27082508, 28416756, 29039488, 29138864, 29215918, 29302045, 29771411, 30015861, 30674889, 31019894, 31142662, 31352238, 31440062, 31793989		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21717425, 29138864, 29295724, 29489064, 29771411, 30064133, 30829316, 31072267, 33824282, 36305048, 36580668, 36603607, 36805336	Associate	★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	18467597		★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	28392220		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	35575252	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Hydrocele	Testicular hydrocele	Pubtator	16252232	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	30175973, 32335297, 33133224, 33419089	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	24577090, 27683118, 31257462, 31846430		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	24126800	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	24577090, 27683118, 31257462, 31846430		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	24126800, 24577090, 27683118, 28645161, 31846430, 39179334	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	25890268, 26036631	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	19921427, 23869586, 29512767, 29744893, 29755127, 30209363, 30257380, 30338806, 30810729, 31427441, 31511359, 31579087, 31838790		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	19921427, 25155634, 28270621, 28423538, 29744893, 30338806, 30602372, 31427441, 34462429, 37217832, 39593161	Associate	★☆☆☆☆ Found in Text Mining only
Tubular Aggregate Myopathy	Tubular Aggregate Myopathy	BEFREE	29038174		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	31366457		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	28940869		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	19706487, 23844063, 26544536, 27744452, 28261684, 28445936, 31115480, 34418989, 37528489	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cancer	Endometrial Cancer	BEFREE	16585218		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25963537, 29207526, 31007650, 31263103, 33740340, 34233586, 35535226, 38183060	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	26321866, 38191418	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	28246385		★☆☆☆☆ Found in Text Mining only