Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6929
Gene name	Transcription factor 3
Gene symbol	TCF3
Synonyms (NCBI Gene)	AGM8AGM8AAGM8BE2AE47ITF1TCF-3VDIRbHLHb21p75
Chromosome	19
Chromosome location	19p13.3
Summary	This gene encodes a member of the E protein (class I) family of helix-loop-helix transcription factors. E proteins activate transcription by binding to regulatory E-box sequences on target genes as heterodimers or homodimers, and are inhibited by heterodi

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs879255271	C>T	Pathogenic	Downstream transcript variant, missense variant, intron variant, coding sequence variant, genic downstream transcript variant, non coding transcript variant
rs1599413207	C>T	Likely-pathogenic	Downstream transcript variant, genic downstream transcript variant, non coding transcript variant, coding sequence variant, missense variant, intron variant

384

Show/Hide all (384)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007321	hsa-miR-17-5p	Luciferase reporter assay	23492770
MIRT007321	hsa-miR-17-5p	Luciferase reporter assay	23492770
MIRT007321	hsa-miR-17-5p	Luciferase reporter assay	23492770
MIRT023195	hsa-miR-124-3p	Microarray	18668037
MIRT044472	hsa-miR-320a	CLASH	23622248
MIRT043732	hsa-miR-342-3p	CLASH	23622248
MIRT040470	hsa-miR-615-3p	CLASH	23622248
MIRT726348	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT726349	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT726347	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT726346	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT732252	hsa-miR-506-3p	Luciferase reporter assayqRT-PCR	27538704
MIRT732252	hsa-miR-506-3p	Luciferase reporter assayqRT-PCR	27538704
MIRT1416177	hsa-miR-103a	CLIP-seq
MIRT1416178	hsa-miR-107	CLIP-seq
MIRT1416179	hsa-miR-1228	CLIP-seq
MIRT1416180	hsa-miR-1254	CLIP-seq
MIRT1416181	hsa-miR-1269	CLIP-seq
MIRT1416182	hsa-miR-1269b	CLIP-seq
MIRT1416183	hsa-miR-1275	CLIP-seq
MIRT1416184	hsa-miR-1288	CLIP-seq
MIRT1416185	hsa-miR-1304	CLIP-seq
MIRT1416186	hsa-miR-137	CLIP-seq
MIRT1416187	hsa-miR-138	CLIP-seq
MIRT1416188	hsa-miR-139-5p	CLIP-seq
MIRT1416189	hsa-miR-15a	CLIP-seq
MIRT1416190	hsa-miR-15b	CLIP-seq
MIRT1416191	hsa-miR-16	CLIP-seq
MIRT1416192	hsa-miR-1827	CLIP-seq
MIRT1416193	hsa-miR-190	CLIP-seq
MIRT1416194	hsa-miR-190b	CLIP-seq
MIRT1416195	hsa-miR-195	CLIP-seq
MIRT1416196	hsa-miR-221	CLIP-seq
MIRT1416197	hsa-miR-222	CLIP-seq
MIRT1416198	hsa-miR-2278	CLIP-seq
MIRT1416199	hsa-miR-2355-5p	CLIP-seq
MIRT1416200	hsa-miR-300	CLIP-seq
MIRT1416201	hsa-miR-3116	CLIP-seq
MIRT1416202	hsa-miR-3119	CLIP-seq
MIRT1416203	hsa-miR-3129-3p	CLIP-seq
MIRT1416204	hsa-miR-3154	CLIP-seq
MIRT1416205	hsa-miR-3163	CLIP-seq
MIRT1416206	hsa-miR-3176	CLIP-seq
MIRT1416207	hsa-miR-3191	CLIP-seq
MIRT1416208	hsa-miR-324-5p	CLIP-seq
MIRT1416209	hsa-miR-331-3p	CLIP-seq
MIRT1416210	hsa-miR-338-3p	CLIP-seq
MIRT1416211	hsa-miR-340	CLIP-seq
MIRT1416212	hsa-miR-3613-3p	CLIP-seq
MIRT1416213	hsa-miR-3618	CLIP-seq
MIRT1416214	hsa-miR-3622a-3p	CLIP-seq
MIRT1416215	hsa-miR-3622b-3p	CLIP-seq
MIRT1416216	hsa-miR-3662	CLIP-seq
MIRT1416217	hsa-miR-3665	CLIP-seq
MIRT1416218	hsa-miR-3689a-5p	CLIP-seq
MIRT1416219	hsa-miR-3689b	CLIP-seq
MIRT1416220	hsa-miR-3689e	CLIP-seq
MIRT1416221	hsa-miR-3689f	CLIP-seq
MIRT1416222	hsa-miR-3690	CLIP-seq
MIRT1416223	hsa-miR-3692	CLIP-seq
MIRT1416224	hsa-miR-3714	CLIP-seq
MIRT1416225	hsa-miR-378	CLIP-seq
MIRT1416226	hsa-miR-378b	CLIP-seq
MIRT1416227	hsa-miR-378c	CLIP-seq
MIRT1416228	hsa-miR-378d	CLIP-seq
MIRT1416229	hsa-miR-378e	CLIP-seq
MIRT1416230	hsa-miR-378f	CLIP-seq
MIRT1416231	hsa-miR-378h	CLIP-seq
MIRT1416232	hsa-miR-378i	CLIP-seq
MIRT1416233	hsa-miR-381	CLIP-seq
MIRT1416234	hsa-miR-3914	CLIP-seq
MIRT1416235	hsa-miR-3921	CLIP-seq
MIRT1416236	hsa-miR-3922-3p	CLIP-seq
MIRT1416237	hsa-miR-3944-5p	CLIP-seq
MIRT1416238	hsa-miR-409-3p	CLIP-seq
MIRT1416239	hsa-miR-422a	CLIP-seq
MIRT1416240	hsa-miR-424	CLIP-seq
MIRT1416241	hsa-miR-4264	CLIP-seq
MIRT1416242	hsa-miR-4271	CLIP-seq
MIRT1416243	hsa-miR-4278	CLIP-seq
MIRT1416244	hsa-miR-4281	CLIP-seq
MIRT1416245	hsa-miR-4282	CLIP-seq
MIRT1416246	hsa-miR-4307	CLIP-seq
MIRT1416247	hsa-miR-4310	CLIP-seq
MIRT1416248	hsa-miR-4328	CLIP-seq
MIRT1416249	hsa-miR-4330	CLIP-seq
MIRT1416250	hsa-miR-4421	CLIP-seq
MIRT1416251	hsa-miR-4427	CLIP-seq
MIRT1416252	hsa-miR-4435	CLIP-seq
MIRT1416253	hsa-miR-4436a	CLIP-seq
MIRT1416254	hsa-miR-4456	CLIP-seq
MIRT1416255	hsa-miR-4462	CLIP-seq
MIRT1416256	hsa-miR-4488	CLIP-seq
MIRT1416257	hsa-miR-4497	CLIP-seq
MIRT1416258	hsa-miR-4515	CLIP-seq
MIRT1416259	hsa-miR-4523	CLIP-seq
MIRT1416260	hsa-miR-4525	CLIP-seq
MIRT1416261	hsa-miR-4642	CLIP-seq
MIRT1416262	hsa-miR-4653-5p	CLIP-seq
MIRT1416263	hsa-miR-4658	CLIP-seq
MIRT1416264	hsa-miR-4665-5p	CLIP-seq
MIRT1416265	hsa-miR-4666-3p	CLIP-seq
MIRT1416266	hsa-miR-4680-3p	CLIP-seq
MIRT1416267	hsa-miR-4697-5p	CLIP-seq
MIRT1416268	hsa-miR-4700-3p	CLIP-seq
MIRT1416269	hsa-miR-4716-3p	CLIP-seq
MIRT1416270	hsa-miR-4720-5p	CLIP-seq
MIRT1416271	hsa-miR-4723-5p	CLIP-seq
MIRT1416272	hsa-miR-4725-3p	CLIP-seq
MIRT1416273	hsa-miR-4740-5p	CLIP-seq
MIRT1416274	hsa-miR-4755-3p	CLIP-seq
MIRT1416275	hsa-miR-4758-5p	CLIP-seq
MIRT1416276	hsa-miR-4765	CLIP-seq
MIRT1416277	hsa-miR-4766-5p	CLIP-seq
MIRT1416278	hsa-miR-4780	CLIP-seq
MIRT1416279	hsa-miR-4786-3p	CLIP-seq
MIRT1416280	hsa-miR-4786-5p	CLIP-seq
MIRT1416281	hsa-miR-4789-5p	CLIP-seq
MIRT1416282	hsa-miR-4793-5p	CLIP-seq
MIRT1416283	hsa-miR-4799-3p	CLIP-seq
MIRT1416284	hsa-miR-485-5p	CLIP-seq
MIRT1416285	hsa-miR-486-3p	CLIP-seq
MIRT1416286	hsa-miR-497	CLIP-seq
MIRT1416287	hsa-miR-512-3p	CLIP-seq
MIRT1416288	hsa-miR-520d-5p	CLIP-seq
MIRT1416289	hsa-miR-524-5p	CLIP-seq
MIRT1416290	hsa-miR-526b	CLIP-seq
MIRT1416291	hsa-miR-548aa	CLIP-seq
MIRT1416292	hsa-miR-548ac	CLIP-seq
MIRT1416293	hsa-miR-548an	CLIP-seq
MIRT1416294	hsa-miR-548d-3p	CLIP-seq
MIRT1416295	hsa-miR-548v	CLIP-seq
MIRT1416296	hsa-miR-548z	CLIP-seq
MIRT1416297	hsa-miR-563	CLIP-seq
MIRT1416298	hsa-miR-583	CLIP-seq
MIRT1416299	hsa-miR-587	CLIP-seq
MIRT1416300	hsa-miR-593	CLIP-seq
MIRT1416301	hsa-miR-598	CLIP-seq
MIRT1416302	hsa-miR-602	CLIP-seq
MIRT1416303	hsa-miR-622	CLIP-seq
MIRT1416304	hsa-miR-625	CLIP-seq
MIRT1416305	hsa-miR-637	CLIP-seq
MIRT1416306	hsa-miR-643	CLIP-seq
MIRT1416307	hsa-miR-646	CLIP-seq
MIRT1416308	hsa-miR-657	CLIP-seq
MIRT1416309	hsa-miR-671-5p	CLIP-seq
MIRT1416310	hsa-miR-922	CLIP-seq
MIRT1416311	hsa-miR-934	CLIP-seq
MIRT1416312	hsa-miR-1915	CLIP-seq
MIRT1416313	hsa-miR-199a-5p	CLIP-seq
MIRT1416314	hsa-miR-199b-5p	CLIP-seq
MIRT1416315	hsa-miR-296-5p	CLIP-seq
MIRT1416316	hsa-miR-3130-5p	CLIP-seq
MIRT1416317	hsa-miR-3174	CLIP-seq
MIRT1416222	hsa-miR-3690	CLIP-seq
MIRT1416318	hsa-miR-3918	CLIP-seq
MIRT1416319	hsa-miR-4254	CLIP-seq
MIRT1416320	hsa-miR-4270	CLIP-seq
MIRT1416321	hsa-miR-4300	CLIP-seq
MIRT1416322	hsa-miR-4441	CLIP-seq
MIRT1416323	hsa-miR-4481	CLIP-seq
MIRT1416324	hsa-miR-4482	CLIP-seq
MIRT1416325	hsa-miR-4536	CLIP-seq
MIRT1416326	hsa-miR-4685-5p	CLIP-seq
MIRT1416269	hsa-miR-4716-3p	CLIP-seq
MIRT1416327	hsa-miR-4717-5p	CLIP-seq
MIRT1416271	hsa-miR-4723-5p	CLIP-seq
MIRT1416328	hsa-miR-4745-5p	CLIP-seq
MIRT1416275	hsa-miR-4758-5p	CLIP-seq
MIRT1416329	hsa-miR-597	CLIP-seq
MIRT1416330	hsa-miR-711	CLIP-seq
MIRT1416331	hsa-miR-920	CLIP-seq
MIRT1416332	hsa-miR-939	CLIP-seq
MIRT1416179	hsa-miR-1228	CLIP-seq
MIRT2124831	hsa-miR-1262	CLIP-seq
MIRT2124832	hsa-miR-1273g	CLIP-seq
MIRT2124833	hsa-miR-1282	CLIP-seq
MIRT2124834	hsa-miR-1291	CLIP-seq
MIRT2124835	hsa-miR-129-5p	CLIP-seq
MIRT1416185	hsa-miR-1304	CLIP-seq
MIRT1416187	hsa-miR-138	CLIP-seq
MIRT1416189	hsa-miR-15a	CLIP-seq
MIRT1416190	hsa-miR-15b	CLIP-seq
MIRT1416191	hsa-miR-16	CLIP-seq
MIRT1416192	hsa-miR-1827	CLIP-seq
MIRT1416193	hsa-miR-190	CLIP-seq
MIRT1416194	hsa-miR-190b	CLIP-seq
MIRT1416312	hsa-miR-1915	CLIP-seq
MIRT1416195	hsa-miR-195	CLIP-seq
MIRT2124836	hsa-miR-24	CLIP-seq
MIRT2124837	hsa-miR-297	CLIP-seq
MIRT1416200	hsa-miR-300	CLIP-seq
MIRT1416202	hsa-miR-3119	CLIP-seq
MIRT2124838	hsa-miR-3150a-3p	CLIP-seq
MIRT2124839	hsa-miR-3175	CLIP-seq
MIRT1416207	hsa-miR-3191	CLIP-seq
MIRT1416208	hsa-miR-324-5p	CLIP-seq
MIRT2124840	hsa-miR-328	CLIP-seq
MIRT1416213	hsa-miR-3618	CLIP-seq
MIRT1416214	hsa-miR-3622a-3p	CLIP-seq
MIRT1416215	hsa-miR-3622b-3p	CLIP-seq
MIRT2124841	hsa-miR-3660	CLIP-seq
MIRT1416218	hsa-miR-3689a-5p	CLIP-seq
MIRT1416219	hsa-miR-3689b	CLIP-seq
MIRT1416220	hsa-miR-3689e	CLIP-seq
MIRT1416221	hsa-miR-3689f	CLIP-seq
MIRT1416223	hsa-miR-3692	CLIP-seq
MIRT1416233	hsa-miR-381	CLIP-seq
MIRT1416234	hsa-miR-3914	CLIP-seq
MIRT1416235	hsa-miR-3921	CLIP-seq
MIRT1416240	hsa-miR-424	CLIP-seq
MIRT1416241	hsa-miR-4264	CLIP-seq
MIRT1416245	hsa-miR-4282	CLIP-seq
MIRT2124842	hsa-miR-4283	CLIP-seq
MIRT2124843	hsa-miR-4299	CLIP-seq
MIRT1416246	hsa-miR-4307	CLIP-seq
MIRT1416249	hsa-miR-4330	CLIP-seq
MIRT1416250	hsa-miR-4421	CLIP-seq
MIRT1416251	hsa-miR-4427	CLIP-seq
MIRT1416253	hsa-miR-4436a	CLIP-seq
MIRT2124844	hsa-miR-4437	CLIP-seq
MIRT2124845	hsa-miR-4452	CLIP-seq
MIRT1416254	hsa-miR-4456	CLIP-seq
MIRT1416255	hsa-miR-4462	CLIP-seq
MIRT2124846	hsa-miR-4506	CLIP-seq
MIRT2124847	hsa-miR-4526	CLIP-seq
MIRT1416261	hsa-miR-4642	CLIP-seq
MIRT1416262	hsa-miR-4653-5p	CLIP-seq
MIRT1416263	hsa-miR-4658	CLIP-seq
MIRT2124848	hsa-miR-4659a-3p	CLIP-seq
MIRT2124849	hsa-miR-4659b-3p	CLIP-seq
MIRT1416265	hsa-miR-4666-3p	CLIP-seq
MIRT2124850	hsa-miR-4667-5p	CLIP-seq
MIRT2124851	hsa-miR-4676-5p	CLIP-seq
MIRT1416266	hsa-miR-4680-3p	CLIP-seq
MIRT2124852	hsa-miR-4691-5p	CLIP-seq
MIRT1416268	hsa-miR-4700-3p	CLIP-seq
MIRT2124853	hsa-miR-4700-5p	CLIP-seq
MIRT2124854	hsa-miR-4701-3p	CLIP-seq
MIRT2124855	hsa-miR-4707-5p	CLIP-seq
MIRT2124856	hsa-miR-4726-3p	CLIP-seq
MIRT2124857	hsa-miR-4728-5p	CLIP-seq
MIRT1416274	hsa-miR-4755-3p	CLIP-seq
MIRT1416275	hsa-miR-4758-5p	CLIP-seq
MIRT1416276	hsa-miR-4765	CLIP-seq
MIRT1416277	hsa-miR-4766-5p	CLIP-seq
MIRT1416278	hsa-miR-4780	CLIP-seq
MIRT1416282	hsa-miR-4793-5p	CLIP-seq
MIRT1416286	hsa-miR-497	CLIP-seq
MIRT2124858	hsa-miR-520g	CLIP-seq
MIRT2124859	hsa-miR-520h	CLIP-seq
MIRT1416290	hsa-miR-526b	CLIP-seq
MIRT1416291	hsa-miR-548aa	CLIP-seq
MIRT2124860	hsa-miR-548q	CLIP-seq
MIRT2124861	hsa-miR-567	CLIP-seq
MIRT2124862	hsa-miR-570	CLIP-seq
MIRT2124863	hsa-miR-575	CLIP-seq
MIRT1416298	hsa-miR-583	CLIP-seq
MIRT1416299	hsa-miR-587	CLIP-seq
MIRT1416300	hsa-miR-593	CLIP-seq
MIRT1416301	hsa-miR-598	CLIP-seq
MIRT1416302	hsa-miR-602	CLIP-seq
MIRT1416303	hsa-miR-622	CLIP-seq
MIRT2124864	hsa-miR-634	CLIP-seq
MIRT1416305	hsa-miR-637	CLIP-seq
MIRT2124865	hsa-miR-873	CLIP-seq
MIRT1416310	hsa-miR-922	CLIP-seq
MIRT1416311	hsa-miR-934	CLIP-seq
MIRT1416332	hsa-miR-939	CLIP-seq
MIRT2124866	hsa-miR-942	CLIP-seq
MIRT2124867	hsa-miR-944	CLIP-seq
MIRT1416177	hsa-miR-103a	CLIP-seq
MIRT1416178	hsa-miR-107	CLIP-seq
MIRT2347253	hsa-miR-1207-5p	CLIP-seq
MIRT1416179	hsa-miR-1228	CLIP-seq
MIRT2347254	hsa-miR-1292	CLIP-seq
MIRT1416186	hsa-miR-137	CLIP-seq
MIRT1416188	hsa-miR-139-5p	CLIP-seq
MIRT1416189	hsa-miR-15a	CLIP-seq
MIRT1416190	hsa-miR-15b	CLIP-seq
MIRT1416191	hsa-miR-16	CLIP-seq
MIRT1416193	hsa-miR-190	CLIP-seq
MIRT1416194	hsa-miR-190b	CLIP-seq
MIRT2347255	hsa-miR-1912	CLIP-seq
MIRT1416312	hsa-miR-1915	CLIP-seq
MIRT1416195	hsa-miR-195	CLIP-seq
MIRT2347256	hsa-miR-205	CLIP-seq
MIRT1416196	hsa-miR-221	CLIP-seq
MIRT1416197	hsa-miR-222	CLIP-seq
MIRT1416200	hsa-miR-300	CLIP-seq
MIRT1416205	hsa-miR-3163	CLIP-seq
MIRT1416208	hsa-miR-324-5p	CLIP-seq
MIRT2347257	hsa-miR-361-3p	CLIP-seq
MIRT2347258	hsa-miR-3622a-5p	CLIP-seq
MIRT2347259	hsa-miR-362-5p	CLIP-seq
MIRT1416216	hsa-miR-3662	CLIP-seq
MIRT1416218	hsa-miR-3689a-5p	CLIP-seq
MIRT1416219	hsa-miR-3689b	CLIP-seq
MIRT1416220	hsa-miR-3689e	CLIP-seq
MIRT1416221	hsa-miR-3689f	CLIP-seq
MIRT1416223	hsa-miR-3692	CLIP-seq
MIRT1416224	hsa-miR-3714	CLIP-seq
MIRT1416233	hsa-miR-381	CLIP-seq
MIRT1416234	hsa-miR-3914	CLIP-seq
MIRT1416318	hsa-miR-3918	CLIP-seq
MIRT2347260	hsa-miR-3922-5p	CLIP-seq
MIRT1416240	hsa-miR-424	CLIP-seq
MIRT1416241	hsa-miR-4264	CLIP-seq
MIRT1416320	hsa-miR-4270	CLIP-seq
MIRT1416244	hsa-miR-4281	CLIP-seq
MIRT1416246	hsa-miR-4307	CLIP-seq
MIRT1416249	hsa-miR-4330	CLIP-seq
MIRT2347261	hsa-miR-4423-3p	CLIP-seq
MIRT1416322	hsa-miR-4441	CLIP-seq
MIRT2347262	hsa-miR-4455	CLIP-seq
MIRT1416254	hsa-miR-4456	CLIP-seq
MIRT2347263	hsa-miR-4457	CLIP-seq
MIRT1416255	hsa-miR-4462	CLIP-seq
MIRT2347264	hsa-miR-4639-5p	CLIP-seq
MIRT2347265	hsa-miR-4640-5p	CLIP-seq
MIRT1416263	hsa-miR-4658	CLIP-seq
MIRT1416265	hsa-miR-4666-3p	CLIP-seq
MIRT1416326	hsa-miR-4685-5p	CLIP-seq
MIRT2347266	hsa-miR-4688	CLIP-seq
MIRT2124856	hsa-miR-4726-3p	CLIP-seq
MIRT2347267	hsa-miR-4726-5p	CLIP-seq
MIRT2124857	hsa-miR-4728-5p	CLIP-seq
MIRT2347268	hsa-miR-4735-5p	CLIP-seq
MIRT1416274	hsa-miR-4755-3p	CLIP-seq
MIRT1416275	hsa-miR-4758-5p	CLIP-seq
MIRT2347269	hsa-miR-4763-3p	CLIP-seq
MIRT1416276	hsa-miR-4765	CLIP-seq
MIRT2347270	hsa-miR-4775	CLIP-seq
MIRT1416278	hsa-miR-4780	CLIP-seq
MIRT1416280	hsa-miR-4786-5p	CLIP-seq
MIRT1416281	hsa-miR-4789-5p	CLIP-seq
MIRT2347271	hsa-miR-4790-5p	CLIP-seq
MIRT1416285	hsa-miR-486-3p	CLIP-seq
MIRT1416286	hsa-miR-497	CLIP-seq
MIRT2347272	hsa-miR-500b	CLIP-seq
MIRT2347273	hsa-miR-502-5p	CLIP-seq
MIRT1416287	hsa-miR-512-3p	CLIP-seq
MIRT2347274	hsa-miR-514	CLIP-seq
MIRT2347275	hsa-miR-514b-3p	CLIP-seq
MIRT2347276	hsa-miR-541	CLIP-seq
MIRT1416291	hsa-miR-548aa	CLIP-seq
MIRT1416292	hsa-miR-548ac	CLIP-seq
MIRT1416293	hsa-miR-548an	CLIP-seq
MIRT1416294	hsa-miR-548d-3p	CLIP-seq
MIRT1416295	hsa-miR-548v	CLIP-seq
MIRT1416296	hsa-miR-548z	CLIP-seq
MIRT1416297	hsa-miR-563	CLIP-seq
MIRT1416299	hsa-miR-587	CLIP-seq
MIRT2347277	hsa-miR-590-3p	CLIP-seq
MIRT1416302	hsa-miR-602	CLIP-seq
MIRT2347278	hsa-miR-615-5p	CLIP-seq
MIRT1416303	hsa-miR-622	CLIP-seq
MIRT1416309	hsa-miR-671-5p	CLIP-seq
MIRT2124865	hsa-miR-873	CLIP-seq
MIRT1416310	hsa-miR-922	CLIP-seq
MIRT2124867	hsa-miR-944	CLIP-seq
MIRT1416186	hsa-miR-137	CLIP-seq
MIRT1416188	hsa-miR-139-5p	CLIP-seq
MIRT1416196	hsa-miR-221	CLIP-seq
MIRT1416197	hsa-miR-222	CLIP-seq
MIRT1416216	hsa-miR-3662	CLIP-seq
MIRT1416223	hsa-miR-3692	CLIP-seq
MIRT1416257	hsa-miR-4497	CLIP-seq
MIRT1416287	hsa-miR-512-3p	CLIP-seq
MIRT1416295	hsa-miR-548v	CLIP-seq
MIRT2124834	hsa-miR-1291	CLIP-seq
MIRT2124840	hsa-miR-328	CLIP-seq
MIRT2124843	hsa-miR-4299	CLIP-seq
MIRT1416254	hsa-miR-4456	CLIP-seq
MIRT2124860	hsa-miR-548q	CLIP-seq
MIRT1416301	hsa-miR-598	CLIP-seq
MIRT1416200	hsa-miR-300	CLIP-seq
MIRT1416212	hsa-miR-3613-3p	CLIP-seq
MIRT1416233	hsa-miR-381	CLIP-seq
MIRT1416245	hsa-miR-4282	CLIP-seq
MIRT1416255	hsa-miR-4462	CLIP-seq
MIRT1416265	hsa-miR-4666-3p	CLIP-seq
MIRT1416281	hsa-miR-4789-5p	CLIP-seq
MIRT1416302	hsa-miR-602	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
FIGLA	Unknown	18499083
ID3	Repression	24492847
LDB1	Repression	10767331
LEF1	Unknown	8479911
LMX1B	Activation	10767331

Show/Hide all (63)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	14576336
GO:0000785	Component	Chromatin	IBA
GO:0000785	Component	Chromatin	IDA	21828274
GO:0000785	Component	Chromatin	ISA
GO:0000791	Component	Euchromatin	IDA	10652346
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	11802795
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	14576336
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IC	21828274
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	14576336
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	10652346, 10775504, 11802795, 14752053, 15509787
GO:0002326	Process	B cell lineage commitment	IDA	15030778
GO:0002326	Process	B cell lineage commitment	NAS	12435739
GO:0003677	Function	DNA binding	IDA	2503252
GO:0003677	Function	DNA binding	IDA	8759016, 10958665
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	2105528, 11509675, 12435739
GO:0003700	Function	DNA-binding transcription factor activity	NAS	2493990
GO:0005515	Function	Protein binding	IPI	7568177, 8759016, 10652346, 10749989, 10915743, 10958665, 11248247, 11940670, 12435739, 14752053, 19321746, 19497860, 21179004, 21828274, 25009770, 25416956, 25466284, 31696227, 32296183, 32814053, 33961781, 35140242
GO:0005634	Component	Nucleus	IDA	10749989, 10775504, 12435739, 12493738, 21828274, 31696227
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	2493990
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005667	Component	Transcription regulator complex	IDA	2503252, 10775504, 15044608
GO:0005737	Component	Cytoplasm	IDA	12435739, 21828274
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	2493990
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007399	Process	Nervous system development	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030183	Process	B cell differentiation	NAS	12435739
GO:0030890	Process	Positive regulation of B cell proliferation	IMP	11509675
GO:0031435	Function	Mitogen-activated protein kinase kinase kinase binding	IPI	19801649
GO:0032991	Component	Protein-containing complex	IDA	12435739
GO:0033152	Process	Immunoglobulin V(D)J recombination	IBA
GO:0033152	Process	Immunoglobulin V(D)J recombination	IDA	16428437
GO:0042803	Function	Protein homodimerization activity	IDA	8759016, 10958665, 14752053
GO:0042803	Function	Protein homodimerization activity	IPI	10652346
GO:0043425	Function	BHLH transcription factor binding	IPI	10545951, 10749989, 10775504, 11802795, 21828274
GO:0045666	Process	Positive regulation of neuron differentiation	ISS
GO:0045787	Process	Positive regulation of cell cycle	IDA	11509675
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	2105528, 11509675, 12435739
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16428437
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10652346, 10775504, 11802795, 15509787, 16043483, 19362560
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	31696227
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046982	Function	Protein heterodimerization activity	IDA	14752053
GO:0046982	Function	Protein heterodimerization activity	IPI	10545951
GO:0046983	Function	Protein dimerization activity	IEA
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IDA	14752053
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	10652346
GO:0070644	Function	Vitamin D response element binding	IDA	17426122
GO:0070888	Function	E-box binding	IDA	10775504
GO:0070888	Function	E-box binding	IDA	7933101, 10652346
GO:0070888	Function	E-box binding	IPI	15044608
GO:0070888	Function	E-box binding	ISS
GO:0090575	Component	RNA polymerase II transcription regulator complex	IDA	10545951, 11802795
GO:0140297	Function	DNA-binding transcription factor binding	IPI	2503252, 12493738, 15044608, 21828274
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IDA	11509675

MIM	HGNC	e!Ensembl
147141	11633	ENSG00000071564

P15923

Protein name

Transcription factor E2-alpha (Class B basic helix-loop-helix protein 21) (bHLHb21) (Immunoglobulin enhancer-binding factor E12/E47) (Immunoglobulin transcription factor 1) (Kappa-E2-binding factor) (Transcription factor 3) (TCF-3) (Transcription factor I

Protein function

Transcriptional regulator involved in the initiation of neuronal differentiation and mesenchymal to epithelial transition (By similarity). Heterodimers between TCF3 and tissue-specific basic helix-loop-helix (bHLH) proteins play major roles in d

PDB

2MH0 , 2YPA , 2YPB , 3U5V , 6MGN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	550 → 603	Helix-loop-helix DNA-binding domain	Domain

Sequence

MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWG
SGDQSSSSFDPSRTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGL
TQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGL
PSSVYPPSSGEDYGRDATAYPSAKTPSSTYPAPFYVADGSLHPSAELWSPPGQAGFGPML
GGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGAT
YGGVSSHTPPVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSP
QGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLP
GHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPD
SYSGLGRAGATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPP
EQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVIL
NLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM

Sequence length

654

Interactions

View interactions

	KEGG		Reactome
	Signaling pathways regulating pluripotency of stem cells Human T-cell leukemia virus 1 infection Transcriptional misregulation in cancer		Myogenesis RUNX1 regulates transcription of genes involved in differentiation of HSCs

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Agammaglobulinemia 8, autosomal dominant	Pathogenic	rs879255271, rs2061880735	RCV000211091 RCV001262287	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Agammaglobulinemia 8b, autosomal recessive	Pathogenic	rs2146131822	RCV002221970	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Multiple myeloma	Likely pathogenic	rs1599413207	RCV000984089	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (37)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL AGAMMAGLOBULINEMIA	—	ClinGen, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL NON-SYNDROMIC AGAMMAGLOBULINEMIA	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-LYMPHOBLASTIC LEUKEMIA/LYMPHOMA WITH T	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BURKITT LYMPHOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Castleman-Kojima disease	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial prostate cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myeloproliferative neoplasm, unclassifiable	Conflicting classifications of pathogenicity; Benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TCF3-related disorder	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOCYTOPENIA, ANASARCA, FEVER, RENAL INSUFFICIENCY, ORGANOMEGALY SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (221)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute leukemia	Leukemia	BEFREE	16173964, 1999956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	1348433, 1516826, 15543624, 17311319, 18024406, 19587702, 21732038, 2243503, 23181981, 24578304, 24990612, 25116187, 25273558, 25551271, 25780007 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	29018453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	15948150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	1348433, 15543624, 25116187, 26214592, 30510082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	24920014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	17550129		★★★★★ ★☆☆☆☆ Found in Text Mining only
African Burkitt`s lymphoma	African Burkitt`s Lymphoma	CTD_human_DG	17244677, 1967982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	Pubtator	24216514	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	GENOMICS_ENGLAND_DG	29114388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
AGAMMAGLOBULINEMIA 8, AUTOSOMAL DOMINANT	Agammaglobulinemia	GENOMICS_ENGLAND_DG	29114388		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
AGAMMAGLOBULINEMIA 8, AUTOSOMAL DOMINANT	Agammaglobulinemia	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Agammaglobulinemia, non-Bruton type	Agammaglobulinemia	ORPHANET_DG	24216514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	22626591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	15056289, 21908873, 24475283, 28228570, 28698670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	28211472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	22984424		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	14613990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anophthalmos	Syndromic microphthalmia	BEFREE	29316906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	37721971	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	16947419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal agammaglobulinemia	Agammaglobulinemia	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28209658, 30567752		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	10905058, 8329708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	26503763		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	12438259, 14997042, 23090119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34700372, 36829181	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	Pubtator	40703516	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Leukemia	Burkitt`s Lymphoma	CTD_human_DG	17244677, 1967982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	CTD_human_DG	17244677, 1967982		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	22885699, 23192177, 24492847, 24493312, 26712879, 28209658, 30127896, 30567752		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	22885699, 26437030, 26468873, 26567765, 26712879, 28209658, 30567752, 32449435, 40572059	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	34658308	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Burkitt Lymphoma	Burkitt`s Lymphoma	ORPHANET_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Byzanthine arch palate	High palate	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30894657, 37607071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	34037532	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	14633602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20331628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	7509279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28592245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24228124, 27461063, 31486487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28604457	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33833226	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	19282835	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	11358448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	11358448		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28385388, 28604457, 30582201		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	28385388, 28604457, 30582201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	BEFREE	28704293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	11700047, 1348433, 15543624, 21152005, 21534874, 25116187, 26214592, 28436581, 29334255, 30510082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG	26214592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	17550129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	17700442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10905058, 8329708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic otitis media	Otitis media	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	25153701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	27433921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23940558, 25375219, 25659031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23940558, 24369055, 24454819, 25375219, 25659031, 32737302	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	26081581, 40703516	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	29806700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Epicanthus	Congenital Epicanthus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Conjunctivitis	Conjunctivitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24228124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	1320571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	BEFREE	28761093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	24047966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	10856157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Desmoid disease hereditary	Desmoid tumor	Pubtator	11437409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Detrusor and sphincter dyssynergia	Detrusor And Sphincter Dyssynergia	BEFREE	29806700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	18566344, 25200302, 31073629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	18566344, 23065828, 25200302, 31073629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	15866349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	10856157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	33663097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Embryonal Neoplasm	Embryonal Neoplasm	BEFREE	16115909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	24939730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28821608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	12032115, 18398367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	37607071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	11732005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	11437409, 15540161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	7578985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ganglioneuroblastoma	Ganglioneuroblastoma	BEFREE	19142969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ganglioneuroma	Ganglioneuroma	BEFREE	19142969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrinoma	Gastrinoma	BEFREE	28859856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	36727359	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27105323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27105323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17696644, 25538243, 27105323, 30092219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36231068, 40653505	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	19169037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	15182431	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	38303515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	23107779, 27461063	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Angioedema Type III	Hereditary angioedema	Pubtator	11398990	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	1691591, 24920014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	GWASDB_DG	24920014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	GWASCAT_DG	24920014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	27166193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	24285878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	LHGDN	17183364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	20506408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	10320052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	10320052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	BEFREE	16054550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	20506408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogammaglobulinemia	Hypogammaglobulinemia	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	18478089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	25153701, 28380447, 28969308, 29604364, 30374941, 31543761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	24516231, 34278464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
L2 Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG	26214592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11369863, 12086872, 19101069, 21536647, 22972988, 24454819, 25137060, 25266309, 28651627, 30894657, 31735627, 33542097, 34597466, 36943767, 7910944, 8159721, 8639829, 9927512 View all (3 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	1386162, 17593026, 18024406, 27894958, 28111340, 30209120, 31735627, 31757791, 8639829, 9494609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	14536079	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	16769578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoid	Lymphoid leukemia	Pubtator	14536079	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	7910944	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10500199, 23091311, 27632978, 30894657, 8327485	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	1835747, 2146981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	8445947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	12149223, 28045896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20549546, 24153013, 30778199, 31421377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28592245	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	28571517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	LHGDN	14536079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	25780007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	16449526, 17272506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	16782810, 17272506, 21788410, 24369055, 34658308	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	9927682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	28209658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	28209658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	18081157, 21938001, 26278479, 28761093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	23576602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	15084380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12438259, 17018605, 23090119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	30741921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28592245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15948150, 17143529, 22564737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11085512, 25088199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	30365150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17143529, 18974393, 19656388, 22274925, 23090119, 24578304, 28604457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28385388, 28604457, 30582201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19738070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	20532534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	17550129		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12789270, 21418516, 8305739, 8908597		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	24047966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	27185256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	17018605, 18403643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	17018605, 18403643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28107608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11389056, 11437409, 11705863, 14997042, 15084380, 15342406, 16555252, 17143529, 17311319, 17973327, 18974393, 19142969, 19738070, 20224295, 20532534 View all (16 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	24475283, 28380447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	16001231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	14654552, 16215672, 19142969, 20404560, 23135478, 23314735, 24253178, 8656283, 9136990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	16705184, 23135478	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29604364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	17550129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonsyndromic Deafness	Nonsyndromic Deafness	BEFREE	29850532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30600185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	14613990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	12741461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	28761093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paranoid Schizophrenia	Paranoid Schizophrenia	BEFREE	28761093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	10319883, 21469209, 24475283, 30941646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	26510930	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	12032115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	14997042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	38303515	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	11700047, 9494609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell acute lymphoblastic leukemia	Lymphoblastic Leukemia	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	10086727, 1999956, 25551271, 27086852, 28436581, 29334255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	ORPHANET_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	10086727, 19282835, 1999956, 2243503, 2268576, 25551271, 9494609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	CTD_human_DG	19246562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	1516826, 17311319, 18024406, 19587702, 2243503, 23181981, 24578304, 25273558, 25551271, 25780007, 27431573, 31305009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	16215946, 17183364, 17311319, 18455790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	CTD_human_DG	26214592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	2268576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary immune deficiency disorder	immunodeficiency	GENOMICS_ENGLAND_DG	29114388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Progressive Aphasia (disorder)	Aphasia	BEFREE	30842294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15948150, 17143529, 22564737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22564737, 27701467	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	11069619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent otitis media	Otitis media	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24228124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	16814783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	16555252, 17973327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	19299559	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	1320571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	BEFREE	22626591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Alveolar Soft Part	Sarcoma	Pubtator	32127467	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	16115909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	21788410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	21788410	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	15540161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30268558, 30895287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	16951226, 28534989, 28560678, 28819854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	28447720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11085512, 25088199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34700372, 35065254, 37100457	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	17272506, 21788410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	30365150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	30365150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31839752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	18081157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	28604457, 35587604	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	32457988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	34278464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TCF3 (transcription factor 3)