Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6924
Gene name	Elongin A
Gene symbol	ELOA
Synonyms (NCBI Gene)	ELOA1SIIISIII p110TCEB3TCEB3A
Chromosome	1
Chromosome location	1p36.11
Summary	This gene encodes the protein elongin A, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymera

Show/Hide all (40)

miRTarBase ID	miRNA	Experiments	Reference
MIRT561471	hsa-miR-3646	PAR-CLIP	20371350
MIRT272814	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT561470	hsa-miR-4760-3p	PAR-CLIP	20371350
MIRT561469	hsa-miR-5196-3p	PAR-CLIP	20371350
MIRT561468	hsa-miR-4793-5p	PAR-CLIP	20371350
MIRT272816	hsa-miR-4786-5p	PAR-CLIP	20371350
MIRT561467	hsa-miR-769-5p	PAR-CLIP	20371350
MIRT272815	hsa-miR-3671	PAR-CLIP	20371350
MIRT272812	hsa-miR-607	PAR-CLIP	20371350
MIRT546345	hsa-miR-587	PAR-CLIP	20371350
MIRT561466	hsa-miR-4677-3p	PAR-CLIP	20371350
MIRT561471	hsa-miR-3646	PAR-CLIP	20371350
MIRT272814	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT561470	hsa-miR-4760-3p	PAR-CLIP	20371350
MIRT561469	hsa-miR-5196-3p	PAR-CLIP	20371350
MIRT561468	hsa-miR-4793-5p	PAR-CLIP	20371350
MIRT272816	hsa-miR-4786-5p	PAR-CLIP	20371350
MIRT561467	hsa-miR-769-5p	PAR-CLIP	20371350
MIRT272815	hsa-miR-3671	PAR-CLIP	20371350
MIRT272812	hsa-miR-607	PAR-CLIP	20371350
MIRT561466	hsa-miR-4677-3p	PAR-CLIP	20371350
MIRT561471	hsa-miR-3646	PAR-CLIP	20371350
MIRT272814	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT561470	hsa-miR-4760-3p	PAR-CLIP	20371350
MIRT561469	hsa-miR-5196-3p	PAR-CLIP	20371350
MIRT561468	hsa-miR-4793-5p	PAR-CLIP	20371350
MIRT272816	hsa-miR-4786-5p	PAR-CLIP	20371350
MIRT561467	hsa-miR-769-5p	PAR-CLIP	20371350
MIRT272815	hsa-miR-3671	PAR-CLIP	20371350
MIRT272812	hsa-miR-607	PAR-CLIP	20371350
MIRT561466	hsa-miR-4677-3p	PAR-CLIP	20371350
MIRT186260	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT186259	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT186265	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT186261	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT186264	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT186263	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT186262	hsa-miR-125b-2-3p	PAR-CLIP	21572407
MIRT546346	hsa-miR-585-5p	PAR-CLIP	21572407
MIRT546345	hsa-miR-587	PAR-CLIP	21572407

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 36217029
GO:0005615	Component	Extracellular space	HDA	22664934
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	7660129
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	IDA	7660122
GO:0006368	Process	Transcription elongation by RNA polymerase II	IEA
GO:0070449	Component	Elongin complex	IDA	7660122
GO:0070449	Component	Elongin complex	IEA
GO:0090734	Component	Site of DNA damage	ISS

MIM	HGNC	e!Ensembl
600786	11620	ENSG00000011007

Q14241

Protein name

Elongin-A (EloA) (Elongin 110 kDa subunit) (RNA polymerase II transcription factor SIII subunit A1) (SIII p110) (Transcription elongation factor B polypeptide 3)

Protein function

SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity i

PDB

4HFX , 6ZUZ , 8OEV , 8OEW , 8OF0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08711	Med26	51 → 102	TFIIS helical bundle-like domain	Domain
PF06881	Elongin_A	592 → 690	RNA polymerase II transcription factor SIII (Elongin) subunit A	Family

Sequence

MHGGRSCGPRTRREPSSGEEAAPVTAMAAESALQVVEKLQARLAANPDPKKLLKYLKKLS
TLPITVDILAETGVGKTVNSLRKHEHVGSFARDLVAQWKKLVPVERNAEPDEQDFEKSNS
RKRPRDALQKEEEMEGDYQETWKATGSRSYSPDHRQKKHRKLSELERPHKVSHGHERRDE
RKRCHRMSPTYSSDPESSDYGHVQSPPSCTSPHQMYVDHYRSLEEDQEPIVSHQKPGKGH
SNAFQDRLGASQERHLGEPHGKGVVSQNKEHKSSHKDKRPVDAKSDEKASVVSREKSHKA
LSKEENRRPPSGDNAREKPPSSGVKKEKDREGSSLKKKCLPPSEAASDNHLKKPKHRDPE
KAKLDKSKQGLDSFDTGKGAGDLLPKVKEKGSNNLKTPEGKVKTNLDRKSLGSLPKVEET
DMEDEFEQPTMSFESYLSYDQPRKKKKKIVKTSATALGDKGLKKNDSKSTGKNLDSVQKL
PKVNKTKSEKPAGADLAKLRKVPDVLPVLPDLPLPAIQANYRPLPSLELISSFQPKRKAF
SSPQEEEEAGFTGRRMNSKMQVYSGSKCAYLPKMMTLHQQCIRVLKNNIDSIFEVGGVPY
SVLEPVLERCTPDQLYRIEEYNHVLIEETDQLWKVHCHRDFKEERPEEYESWREMYLRLQ
DAREQRLRVLTKNIQFAHANKPKGRQAKMAFVNSVAKPPRDVRRRQEKFGTGGAAVPEKI
KIKPAPYPMGSSHASASSISFNPSPEEPAYDGPSTSSAHLAPVVSSTVSYDPRKPTVKKI
APMMAKTIKAFKNRFSRR

Sequence length

798

Interactions

View interactions

	Reactome
			Formation of RNA Pol II elongation complex RNA Polymerase II Pre-transcription Events TP53 Regulates Transcription of DNA Repair Genes RNA Polymerase II Transcription Elongation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	9931330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30809972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brugada Syndrome (disorder)	Brugada Syndrome	BEFREE	29608225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36376892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	9931330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	31677940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	34400640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	9931330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	21887344	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31677940, 9516832, 9931330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	9931330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	GWASCAT_DG	25574825		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tachycardia, Ventricular	Ventricular tachycardia	BEFREE	29608225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	9931330		★★★★★ ★☆☆☆☆ Found in Text Mining only

ELOA (elongin A)