Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6921
Gene name	Elongin C
Gene symbol	ELOC
Synonyms (NCBI Gene)	SIIITCEB1
Chromosome	8
Chromosome location	8q21.11
Summary	This gene encodes the protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymera

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1057519973	T>A,G	Likely-pathogenic	Missense variant, coding sequence variant
rs1057519974	A>T	Likely-pathogenic	Missense variant, coding sequence variant

153

Show/Hide all (153)

miRTarBase ID	miRNA	Experiments	Reference
MIRT616179	hsa-miR-106a-5p	HITS-CLIP	23824327
MIRT616178	hsa-miR-106b-5p	HITS-CLIP	23824327
MIRT616177	hsa-miR-17-5p	HITS-CLIP	23824327
MIRT616176	hsa-miR-20a-5p	HITS-CLIP	23824327
MIRT616175	hsa-miR-20b-5p	HITS-CLIP	23824327
MIRT616174	hsa-miR-519d-3p	HITS-CLIP	23824327
MIRT616173	hsa-miR-526b-3p	HITS-CLIP	23824327
MIRT616172	hsa-miR-93-5p	HITS-CLIP	23824327
MIRT616171	hsa-miR-302a-3p	HITS-CLIP	23824327
MIRT616170	hsa-miR-302b-3p	HITS-CLIP	23824327
MIRT616169	hsa-miR-302c-3p	HITS-CLIP	23824327
MIRT616168	hsa-miR-302d-3p	HITS-CLIP	23824327
MIRT616167	hsa-miR-302e	HITS-CLIP	23824327
MIRT616166	hsa-miR-372-3p	HITS-CLIP	23824327
MIRT616165	hsa-miR-373-3p	HITS-CLIP	23824327
MIRT616164	hsa-miR-520a-3p	HITS-CLIP	23824327
MIRT616163	hsa-miR-520b	HITS-CLIP	23824327
MIRT616162	hsa-miR-520c-3p	HITS-CLIP	23824327
MIRT616161	hsa-miR-520d-3p	HITS-CLIP	23824327
MIRT616160	hsa-miR-520e	HITS-CLIP	23824327
MIRT616159	hsa-miR-512-3p	HITS-CLIP	23824327
MIRT616158	hsa-miR-146a-3p	HITS-CLIP	23824327
MIRT616157	hsa-miR-4766-5p	HITS-CLIP	23824327
MIRT616156	hsa-miR-3909	HITS-CLIP	23824327
MIRT616155	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT616154	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT616179	hsa-miR-106a-5p	HITS-CLIP	23824327
MIRT616178	hsa-miR-106b-5p	HITS-CLIP	23824327
MIRT616177	hsa-miR-17-5p	HITS-CLIP	23824327
MIRT616176	hsa-miR-20a-5p	HITS-CLIP	23824327
MIRT616175	hsa-miR-20b-5p	HITS-CLIP	23824327
MIRT616174	hsa-miR-519d-3p	HITS-CLIP	23824327
MIRT616173	hsa-miR-526b-3p	HITS-CLIP	23824327
MIRT616172	hsa-miR-93-5p	HITS-CLIP	23824327
MIRT616171	hsa-miR-302a-3p	HITS-CLIP	23824327
MIRT616170	hsa-miR-302b-3p	HITS-CLIP	23824327
MIRT616169	hsa-miR-302c-3p	HITS-CLIP	23824327
MIRT616168	hsa-miR-302d-3p	HITS-CLIP	23824327
MIRT616167	hsa-miR-302e	HITS-CLIP	23824327
MIRT616166	hsa-miR-372-3p	HITS-CLIP	23824327
MIRT616165	hsa-miR-373-3p	HITS-CLIP	23824327
MIRT616164	hsa-miR-520a-3p	HITS-CLIP	23824327
MIRT616163	hsa-miR-520b	HITS-CLIP	23824327
MIRT616162	hsa-miR-520c-3p	HITS-CLIP	23824327
MIRT616161	hsa-miR-520d-3p	HITS-CLIP	23824327
MIRT616160	hsa-miR-520e	HITS-CLIP	23824327
MIRT616159	hsa-miR-512-3p	HITS-CLIP	23824327
MIRT616158	hsa-miR-146a-3p	HITS-CLIP	23824327
MIRT616157	hsa-miR-4766-5p	HITS-CLIP	23824327
MIRT616156	hsa-miR-3909	HITS-CLIP	23824327
MIRT616155	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT616154	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT636200	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT636199	hsa-miR-5683	HITS-CLIP	23824327
MIRT636198	hsa-miR-4740-3p	HITS-CLIP	23824327
MIRT636197	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT636196	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT636195	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT636194	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT636193	hsa-miR-1976	HITS-CLIP	23824327
MIRT636192	hsa-miR-619-5p	HITS-CLIP	23824327
MIRT636191	hsa-miR-6506-5p	HITS-CLIP	23824327
MIRT636190	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT636189	hsa-miR-4713-3p	HITS-CLIP	23824327
MIRT636188	hsa-miR-638	HITS-CLIP	23824327
MIRT636187	hsa-miR-4279	HITS-CLIP	23824327
MIRT636186	hsa-miR-450b-3p	HITS-CLIP	23824327
MIRT636185	hsa-miR-769-3p	HITS-CLIP	23824327
MIRT616179	hsa-miR-106a-5p	HITS-CLIP	23824327
MIRT616178	hsa-miR-106b-5p	HITS-CLIP	23824327
MIRT616177	hsa-miR-17-5p	HITS-CLIP	23824327
MIRT616176	hsa-miR-20a-5p	HITS-CLIP	23824327
MIRT616175	hsa-miR-20b-5p	HITS-CLIP	23824327
MIRT616174	hsa-miR-519d-3p	HITS-CLIP	23824327
MIRT616173	hsa-miR-526b-3p	HITS-CLIP	23824327
MIRT616172	hsa-miR-93-5p	HITS-CLIP	23824327
MIRT616171	hsa-miR-302a-3p	HITS-CLIP	23824327
MIRT616170	hsa-miR-302b-3p	HITS-CLIP	23824327
MIRT616169	hsa-miR-302c-3p	HITS-CLIP	23824327
MIRT616168	hsa-miR-302d-3p	HITS-CLIP	23824327
MIRT616167	hsa-miR-302e	HITS-CLIP	23824327
MIRT616166	hsa-miR-372-3p	HITS-CLIP	23824327
MIRT616165	hsa-miR-373-3p	HITS-CLIP	23824327
MIRT616164	hsa-miR-520a-3p	HITS-CLIP	23824327
MIRT616163	hsa-miR-520b	HITS-CLIP	23824327
MIRT616162	hsa-miR-520c-3p	HITS-CLIP	23824327
MIRT616161	hsa-miR-520d-3p	HITS-CLIP	23824327
MIRT616160	hsa-miR-520e	HITS-CLIP	23824327
MIRT616158	hsa-miR-146a-3p	HITS-CLIP	23824327
MIRT616157	hsa-miR-4766-5p	HITS-CLIP	23824327
MIRT616156	hsa-miR-3909	HITS-CLIP	23824327
MIRT616155	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT616154	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT616179	hsa-miR-106a-5p	HITS-CLIP	23824327
MIRT616178	hsa-miR-106b-5p	HITS-CLIP	23824327
MIRT616177	hsa-miR-17-5p	HITS-CLIP	23824327
MIRT616176	hsa-miR-20a-5p	HITS-CLIP	23824327
MIRT616175	hsa-miR-20b-5p	HITS-CLIP	23824327
MIRT616174	hsa-miR-519d-3p	HITS-CLIP	23824327
MIRT616173	hsa-miR-526b-3p	HITS-CLIP	23824327
MIRT616172	hsa-miR-93-5p	HITS-CLIP	23824327
MIRT616171	hsa-miR-302a-3p	HITS-CLIP	23824327
MIRT616170	hsa-miR-302b-3p	HITS-CLIP	23824327
MIRT616169	hsa-miR-302c-3p	HITS-CLIP	23824327
MIRT616168	hsa-miR-302d-3p	HITS-CLIP	23824327
MIRT616167	hsa-miR-302e	HITS-CLIP	23824327
MIRT616166	hsa-miR-372-3p	HITS-CLIP	23824327
MIRT616165	hsa-miR-373-3p	HITS-CLIP	23824327
MIRT616164	hsa-miR-520a-3p	HITS-CLIP	23824327
MIRT616163	hsa-miR-520b	HITS-CLIP	23824327
MIRT616162	hsa-miR-520c-3p	HITS-CLIP	23824327
MIRT616161	hsa-miR-520d-3p	HITS-CLIP	23824327
MIRT616160	hsa-miR-520e	HITS-CLIP	23824327
MIRT616158	hsa-miR-146a-3p	HITS-CLIP	23824327
MIRT616157	hsa-miR-4766-5p	HITS-CLIP	23824327
MIRT616156	hsa-miR-3909	HITS-CLIP	23824327
MIRT616155	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT616154	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT616179	hsa-miR-106a-5p	HITS-CLIP	23824327
MIRT616178	hsa-miR-106b-5p	HITS-CLIP	23824327
MIRT616177	hsa-miR-17-5p	HITS-CLIP	23824327
MIRT616176	hsa-miR-20a-5p	HITS-CLIP	23824327
MIRT616175	hsa-miR-20b-5p	HITS-CLIP	23824327
MIRT616174	hsa-miR-519d-3p	HITS-CLIP	23824327
MIRT616173	hsa-miR-526b-3p	HITS-CLIP	23824327
MIRT616172	hsa-miR-93-5p	HITS-CLIP	23824327
MIRT616171	hsa-miR-302a-3p	HITS-CLIP	23824327
MIRT616170	hsa-miR-302b-3p	HITS-CLIP	23824327
MIRT616169	hsa-miR-302c-3p	HITS-CLIP	23824327
MIRT616168	hsa-miR-302d-3p	HITS-CLIP	23824327
MIRT616167	hsa-miR-302e	HITS-CLIP	23824327
MIRT616166	hsa-miR-372-3p	HITS-CLIP	23824327
MIRT616165	hsa-miR-373-3p	HITS-CLIP	23824327
MIRT616164	hsa-miR-520a-3p	HITS-CLIP	23824327
MIRT616163	hsa-miR-520b	HITS-CLIP	23824327
MIRT616162	hsa-miR-520c-3p	HITS-CLIP	23824327
MIRT616161	hsa-miR-520d-3p	HITS-CLIP	23824327
MIRT616160	hsa-miR-520e	HITS-CLIP	23824327
MIRT616159	hsa-miR-512-3p	HITS-CLIP	23824327
MIRT616158	hsa-miR-146a-3p	HITS-CLIP	23824327
MIRT616157	hsa-miR-4766-5p	HITS-CLIP	23824327
MIRT616156	hsa-miR-3909	HITS-CLIP	23824327
MIRT616155	hsa-miR-6852-3p	HITS-CLIP	23824327
MIRT616154	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT500830	hsa-miR-132-3p	PAR-CLIP	24398324
MIRT500829	hsa-miR-212-3p	PAR-CLIP	24398324
MIRT500827	hsa-miR-200b-3p	PAR-CLIP	24398324
MIRT500828	hsa-miR-429	PAR-CLIP	24398324
MIRT500826	hsa-miR-200c-3p	PAR-CLIP	24398324
MIRT500825	hsa-miR-552-3p	PAR-CLIP	24398324
MIRT500823	hsa-miR-4724-5p	PAR-CLIP	24398324
MIRT500824	hsa-miR-4678	PAR-CLIP	24398324
MIRT500822	hsa-miR-4424	PAR-CLIP	24398324

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IEA
GO:0001222	Function	Transcription corepressor binding	IPI	7660122
GO:0005515	Function	Protein binding	IPI	10205047, 10851083, 12004076, 12050673, 12149480, 15590694, 15601820, 16189514, 16643902, 17183367, 19159283, 19322197, 19327355, 20211142, 21119685, 21145461, 21199876, 21516116, 21822215, 21988832, 22190034, 22510880, 23460923, 23563313, 25416956, 28514442, 31515488, 31980649, 322
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	7660129
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	IDA	7660122
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0016567	Process	Protein ubiquitination	IDA	30166453
GO:0016567	Process	Protein ubiquitination	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IBA
GO:0031462	Component	Cul2-RING ubiquitin ligase complex	ISS
GO:0031466	Component	Cul5-RING ubiquitin ligase complex	IDA	21980433, 23837592, 25505247, 30166453, 31387940, 32513959, 33268465, 34857742, 35512830, 37816714, 38418882
GO:0031466	Component	Cul5-RING ubiquitin ligase complex	IEA
GO:0070449	Component	Elongin complex	IBA
GO:0070449	Component	Elongin complex	IDA	7660122
GO:0070449	Component	Elongin complex	IEA
GO:0140958	Process	Target-directed miRNA degradation	IMP	33184237

MIM	HGNC	e!Ensembl
600788	11617	ENSG00000154582

Q15369

Protein name

Elongin-C (EloC) (Elongin 15 kDa subunit) (RNA polymerase II transcription factor SIII subunit C) (SIII p15) (Transcription elongation factor B polypeptide 1)

Protein function

SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity i

PDB

1LM8 , 1LQB , 1VCB , 2C9W , 2IZV , 2MA9 , 3DCG , 3ZKJ , 3ZNG , 3ZRC , 3ZRF , 3ZTC , 3ZTD , 3ZUN , 4AJY , 4AWJ , 4B95 , 4B9K , 4BKS , 4BKT , 4N9F , 4W9C , 4W9D , 4W9E , 4W9F , 4W9G , 4W9H , 4W9I , 4W9J , 4W9K , 4W9L , 4WQO , 5BO4 , 5LLI , 5N4W , 5NVV , 5NVW , 5NVX , 5NVY , 5NVZ , 5NW0 , 5NW1 , 5NW2 , 5T35 , 6BVB , 6C5X , 6FMI , 6FMJ , 6FMK , 6GFX , 6GFY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03931	Skp1_POZ	17 → 82	Skp1 family, tetramerisation domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Overexpressed in prostate cancer cell line PC-3 and breast cancer cell line SK-BR-3. {ECO:0000269|PubMed:12004003}.

Sequence

MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV
NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

Sequence length

112

Interactions

View interactions

	KEGG		Reactome
	HIF-1 signaling pathway Ubiquitin mediated proteolysis Human immunodeficiency virus 1 infection Pathways in cancer Renal cell carcinoma		Formation of RNA Pol II elongation complex Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha Vif-mediated degradation of APOBEC3G RNA Polymerase II Pre-transcription Events TP53 Regulates Transcription of DNA Repair Genes RNA Polymerase II Transcription Elongation Neddylation Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, RENAL CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (42)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	19408298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30809972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12004003, 20139910, 20680678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12004003, 20139910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brugada Syndrome (disorder)	Brugada Syndrome	BEFREE	29608225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12004003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24821879, 25676555, 28731045, 31813809, 32251007, 34512202, 35323939, 37088333, 37964489	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	23797736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear cell papillary renal cell carcinoma	Papillary Renal Carcinoma	BEFREE	25676555, 27923499, 28731045, 30986793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	30565303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	23797736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	23797736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24969085, 25676555, 27684973, 28052007, 28731045, 30565303, 30986793, 31155438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	31677940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	30265751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	9447969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	37088333	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29991678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12004003, 20139910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	30565303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12004003, 23083832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28667082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	36753617	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MiT family translocation renal cell carcinoma	Renal Carcinoma	BEFREE	28731045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25676555, 30565303, 31677940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	27684973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	23797736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	28731045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	34477128	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	BEFREE	24969085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12004003, 23083832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12004003	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	18844214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18844214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	30565303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	23797736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25676555, 27684973, 28731045, 29084058, 30986793, 31155438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CLINVAR_DG	26619011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	23797736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tachycardia, Ventricular	Ventricular tachycardia	BEFREE	29608225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	31850909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	10587522, 24969085		★★★★★ ★☆☆☆☆ Found in Text Mining only

ELOC (elongin C)