Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	6920
Gene name	Transcription elongation factor A3
Gene symbol	TCEA3
Synonyms (NCBI Gene)	TFIISTFIIS.H
Chromosome	1
Chromosome location	1p36.12

102

Show/Hide all (102)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017460	hsa-miR-335-5p	Microarray	18185580
MIRT030391	hsa-miR-24-3p	Microarray	19748357
MIRT452772	hsa-miR-6808-5p	PAR-CLIP	21572407
MIRT452771	hsa-miR-6893-5p	PAR-CLIP	21572407
MIRT452770	hsa-miR-940	PAR-CLIP	21572407
MIRT452769	hsa-miR-4459	PAR-CLIP	21572407
MIRT452768	hsa-miR-4433a-3p	PAR-CLIP	21572407
MIRT550111	hsa-miR-665	PAR-CLIP	21572407
MIRT452767	hsa-miR-6840-3p	PAR-CLIP	21572407
MIRT452765	hsa-miR-4786-5p	PAR-CLIP	21572407
MIRT452764	hsa-miR-769-5p	PAR-CLIP	21572407
MIRT452763	hsa-miR-1225-3p	PAR-CLIP	21572407
MIRT452762	hsa-miR-1233-3p	PAR-CLIP	21572407
MIRT452761	hsa-miR-1827	PAR-CLIP	21572407
MIRT452760	hsa-miR-4722-5p	PAR-CLIP	21572407
MIRT452759	hsa-miR-6894-5p	PAR-CLIP	21572407
MIRT452758	hsa-miR-3672	PAR-CLIP	21572407
MIRT452757	hsa-miR-6864-3p	PAR-CLIP	21572407
MIRT452756	hsa-miR-6807-5p	PAR-CLIP	21572407
MIRT452755	hsa-miR-1273e	PAR-CLIP	21572407
MIRT514923	hsa-miR-6771-3p	PAR-CLIP	23446348
MIRT452772	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT452771	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT452770	hsa-miR-940	PAR-CLIP	23592263
MIRT452769	hsa-miR-4459	PAR-CLIP	23592263
MIRT452768	hsa-miR-4433a-3p	PAR-CLIP	23592263
MIRT452767	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT452766	hsa-miR-4649-3p	PAR-CLIP	23592263
MIRT452765	hsa-miR-4786-5p	PAR-CLIP	23592263
MIRT452764	hsa-miR-769-5p	PAR-CLIP	23592263
MIRT452763	hsa-miR-1225-3p	PAR-CLIP	23592263
MIRT452762	hsa-miR-1233-3p	PAR-CLIP	23592263
MIRT452761	hsa-miR-1827	PAR-CLIP	23592263
MIRT452760	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT452759	hsa-miR-6894-5p	PAR-CLIP	23592263
MIRT452758	hsa-miR-3672	PAR-CLIP	23592263
MIRT452757	hsa-miR-6864-3p	PAR-CLIP	23592263
MIRT452756	hsa-miR-6807-5p	PAR-CLIP	23592263
MIRT452755	hsa-miR-1273e	PAR-CLIP	23592263
MIRT452768	hsa-miR-4433a-3p	PAR-CLIP	27292025
MIRT452769	hsa-miR-4459	PAR-CLIP	27292025
MIRT452765	hsa-miR-4786-5p	PAR-CLIP	27292025
MIRT514923	hsa-miR-6771-3p	PAR-CLIP	27292025
MIRT452772	hsa-miR-6808-5p	PAR-CLIP	21572407
MIRT452771	hsa-miR-6893-5p	PAR-CLIP	21572407
MIRT452770	hsa-miR-940	PAR-CLIP	21572407
MIRT452769	hsa-miR-4459	PAR-CLIP	21572407
MIRT452768	hsa-miR-4433a-3p	PAR-CLIP	21572407
MIRT550111	hsa-miR-665	PAR-CLIP	21572407
MIRT452767	hsa-miR-6840-3p	PAR-CLIP	21572407
MIRT452765	hsa-miR-4786-5p	PAR-CLIP	21572407
MIRT452764	hsa-miR-769-5p	PAR-CLIP	21572407
MIRT452763	hsa-miR-1225-3p	PAR-CLIP	21572407
MIRT452762	hsa-miR-1233-3p	PAR-CLIP	21572407
MIRT452761	hsa-miR-1827	PAR-CLIP	21572407
MIRT452760	hsa-miR-4722-5p	PAR-CLIP	21572407
MIRT452759	hsa-miR-6894-5p	PAR-CLIP	21572407
MIRT452758	hsa-miR-3672	PAR-CLIP	21572407
MIRT452757	hsa-miR-6864-3p	PAR-CLIP	21572407
MIRT452756	hsa-miR-6807-5p	PAR-CLIP	21572407
MIRT452755	hsa-miR-1273e	PAR-CLIP	21572407
MIRT514923	hsa-miR-6771-3p	PAR-CLIP	23446348
MIRT452772	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT452771	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT452770	hsa-miR-940	PAR-CLIP	23592263
MIRT452769	hsa-miR-4459	PAR-CLIP	23592263
MIRT452768	hsa-miR-4433a-3p	PAR-CLIP	23592263
MIRT452767	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT452766	hsa-miR-4649-3p	PAR-CLIP	23592263
MIRT452765	hsa-miR-4786-5p	PAR-CLIP	23592263
MIRT452764	hsa-miR-769-5p	PAR-CLIP	23592263
MIRT452763	hsa-miR-1225-3p	PAR-CLIP	23592263
MIRT452762	hsa-miR-1233-3p	PAR-CLIP	23592263
MIRT452761	hsa-miR-1827	PAR-CLIP	23592263
MIRT452760	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT452759	hsa-miR-6894-5p	PAR-CLIP	23592263
MIRT452758	hsa-miR-3672	PAR-CLIP	23592263
MIRT452757	hsa-miR-6864-3p	PAR-CLIP	23592263
MIRT452756	hsa-miR-6807-5p	PAR-CLIP	23592263
MIRT452755	hsa-miR-1273e	PAR-CLIP	23592263
MIRT1415542	hsa-miR-137	CLIP-seq
MIRT1415543	hsa-miR-145	CLIP-seq
MIRT1415544	hsa-miR-3123	CLIP-seq
MIRT1415545	hsa-miR-3925-3p	CLIP-seq
MIRT1415546	hsa-miR-3942-3p	CLIP-seq
MIRT1415547	hsa-miR-3977	CLIP-seq
MIRT1415548	hsa-miR-4263	CLIP-seq
MIRT1415549	hsa-miR-4477a	CLIP-seq
MIRT1415550	hsa-miR-450b-5p	CLIP-seq
MIRT1415551	hsa-miR-4696	CLIP-seq
MIRT1415552	hsa-miR-4760-3p	CLIP-seq
MIRT1415553	hsa-miR-4775	CLIP-seq
MIRT1415554	hsa-miR-515-5p	CLIP-seq
MIRT1415555	hsa-miR-516a-3p	CLIP-seq
MIRT1415556	hsa-miR-576-5p	CLIP-seq
MIRT1415557	hsa-miR-766	CLIP-seq
MIRT1415553	hsa-miR-4775	CLIP-seq
MIRT2347074	hsa-miR-205	CLIP-seq
MIRT1415548	hsa-miR-4263	CLIP-seq
MIRT1415549	hsa-miR-4477a	CLIP-seq
MIRT1415553	hsa-miR-4775	CLIP-seq
MIRT1415556	hsa-miR-576-5p	CLIP-seq

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006368	Process	Transcription elongation by RNA polymerase II	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
604128	11615	ENSG00000204219

O75764

Protein name

Transcription elongation factor A protein 3 (Transcription elongation factor S-II protein 3) (Transcription elongation factor TFIIS.h)

Protein function

Necessary for efficient RNA polymerase II transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in l

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08711	Med26	26 → 79	TFIIS helical bundle-like domain	Domain
PF07500	TFIIS_M	185 → 295	Transcription factor S-II (TFIIS), central domain	Domain
PF01096	TFIIS_C	308 → 346	Transcription factor S-II (TFIIS)	Domain

Sequence

MGQEEELLRIAKKLEKMVARKNTEGALDLLKKLHSCQMSIQLLQTTRIGVAVNGVRKHCS
DKEVVSLAKVLIKNWKRLLDSPGPPKGEKGEEREKAKKKEKGLECSDWKPEAGLSPPRKK
REDPKTRRDSVDSKSSASSSPKRPSVERSNSSKSKAESPKTPSSPLTPTFASSMCLLAPC
YLTGDSVRDKCVEMLSAALKADDDYKDYGVNCDKMASEIEDHIYQELKSTDMKYRNRVRS
RISNLKDPRNPGLRRNVLSGAISAGLIAKMTAEEMASDELRELRNAMTQEAIREHQMAKT
GGTTTDLFQCSKCKKKNCTYNQVQTRSADEPMTTFVLCNECGNRWKFC

Sequence length

348

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Biliary Atresia	Biliary atresia	Pubtator	40665272	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18474089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18474089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18474089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	18474089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18474089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	18474089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31988307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	31988307	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26498664	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

TCEA3 (transcription elongation factor A3)