Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6915
Gene name	Thromboxane A2 receptor
Gene symbol	TBXA2R
Synonyms (NCBI Gene)	BDPLT13TXA2-R
Chromosome	19
Chromosome location	19p13.3
Summary	This gene encodes a member of the G protein-coupled receptor family. The protein interacts with thromboxane A2 to induce platelet aggregation and regulate hemostasis. A mutation in this gene results in a bleeding disorder. Multiple transcript variants enc

Show/Hide all (4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs387906691	C>T	Risk-factor	Coding sequence variant, missense variant
rs397514542	A>C	Risk-factor	Coding sequence variant, missense variant
rs1131691334	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1599869510	T>C	Likely-pathogenic	Splice acceptor variant

310

Show/Hide all (310)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022135	hsa-miR-124-3p	Microarray	18668037
MIRT054726	hsa-miR-31-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	24558106
MIRT054726	hsa-miR-31-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	24558106
MIRT684264	hsa-miR-4432	HITS-CLIP	23313552
MIRT684263	hsa-miR-508-5p	HITS-CLIP	23313552
MIRT684262	hsa-miR-451b	HITS-CLIP	23313552
MIRT684261	hsa-miR-6501-3p	HITS-CLIP	23313552
MIRT684260	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT684259	hsa-miR-340-3p	HITS-CLIP	23313552
MIRT684258	hsa-miR-6827-3p	HITS-CLIP	23313552
MIRT684257	hsa-miR-6852-5p	HITS-CLIP	23313552
MIRT684256	hsa-miR-766-3p	HITS-CLIP	23313552
MIRT684255	hsa-miR-637	HITS-CLIP	23313552
MIRT684254	hsa-miR-4696	HITS-CLIP	23313552
MIRT684253	hsa-miR-661	HITS-CLIP	23313552
MIRT684252	hsa-miR-625-5p	HITS-CLIP	23313552
MIRT684251	hsa-miR-4723-5p	HITS-CLIP	23313552
MIRT684250	hsa-miR-5698	HITS-CLIP	23313552
MIRT684249	hsa-miR-6870-5p	HITS-CLIP	23313552
MIRT684248	hsa-miR-7111-5p	HITS-CLIP	23313552
MIRT684247	hsa-miR-4525	HITS-CLIP	23313552
MIRT684246	hsa-miR-5010-5p	HITS-CLIP	23313552
MIRT684245	hsa-miR-6512-3p	HITS-CLIP	23313552
MIRT684244	hsa-miR-6720-5p	HITS-CLIP	23313552
MIRT684243	hsa-miR-1275	HITS-CLIP	23313552
MIRT684242	hsa-miR-4665-5p	HITS-CLIP	23313552
MIRT639355	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT639354	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT639353	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT639352	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT639351	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT639350	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT639349	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT639348	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT639347	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT639346	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT639345	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT639344	hsa-miR-507	HITS-CLIP	23824327
MIRT639343	hsa-miR-557	HITS-CLIP	23824327
MIRT639342	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT466537	hsa-miR-3929	PAR-CLIP	23592263
MIRT466536	hsa-miR-4419b	PAR-CLIP	23592263
MIRT466535	hsa-miR-4478	PAR-CLIP	23592263
MIRT466534	hsa-miR-383-3p	PAR-CLIP	23592263
MIRT466533	hsa-miR-4679	PAR-CLIP	23592263
MIRT466532	hsa-miR-485-5p	PAR-CLIP	23592263
MIRT466531	hsa-miR-6884-5p	PAR-CLIP	23592263
MIRT466530	hsa-miR-214-5p	PAR-CLIP	23592263
MIRT466529	hsa-miR-6811-3p	PAR-CLIP	23592263
MIRT466528	hsa-miR-7160-5p	PAR-CLIP	23592263
MIRT466527	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT466526	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT466525	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT466524	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT466523	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT466522	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT466521	hsa-miR-203a-5p	PAR-CLIP	23592263
MIRT466520	hsa-miR-1206	PAR-CLIP	23592263
MIRT466519	hsa-miR-7977	PAR-CLIP	23592263
MIRT466518	hsa-miR-6514-3p	PAR-CLIP	23592263
MIRT466517	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT466516	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT466515	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT466514	hsa-miR-1273h-5p	PAR-CLIP	23592263
MIRT466513	hsa-miR-30b-3p	PAR-CLIP	23592263
MIRT466512	hsa-miR-3689a-3p	PAR-CLIP	23592263
MIRT466511	hsa-miR-3689b-3p	PAR-CLIP	23592263
MIRT466510	hsa-miR-3689c	PAR-CLIP	23592263
MIRT466509	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT466508	hsa-miR-6780a-5p	PAR-CLIP	23592263
MIRT466507	hsa-miR-450a-1-3p	PAR-CLIP	23592263
MIRT466506	hsa-miR-3122	PAR-CLIP	23592263
MIRT466505	hsa-miR-3913-5p	PAR-CLIP	23592263
MIRT466504	hsa-miR-887-5p	PAR-CLIP	23592263
MIRT466503	hsa-miR-6513-5p	PAR-CLIP	23592263
MIRT466502	hsa-miR-566	PAR-CLIP	23592263
MIRT466501	hsa-miR-665	PAR-CLIP	23592263
MIRT684264	hsa-miR-4432	HITS-CLIP	23313552
MIRT684263	hsa-miR-508-5p	HITS-CLIP	23313552
MIRT684262	hsa-miR-451b	HITS-CLIP	23313552
MIRT684261	hsa-miR-6501-3p	HITS-CLIP	23313552
MIRT684260	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT684259	hsa-miR-340-3p	HITS-CLIP	23313552
MIRT684258	hsa-miR-6827-3p	HITS-CLIP	23313552
MIRT684257	hsa-miR-6852-5p	HITS-CLIP	23313552
MIRT684256	hsa-miR-766-3p	HITS-CLIP	23313552
MIRT684255	hsa-miR-637	HITS-CLIP	23313552
MIRT684254	hsa-miR-4696	HITS-CLIP	23313552
MIRT684253	hsa-miR-661	HITS-CLIP	23313552
MIRT684252	hsa-miR-625-5p	HITS-CLIP	23313552
MIRT684251	hsa-miR-4723-5p	HITS-CLIP	23313552
MIRT684250	hsa-miR-5698	HITS-CLIP	23313552
MIRT684249	hsa-miR-6870-5p	HITS-CLIP	23313552
MIRT684248	hsa-miR-7111-5p	HITS-CLIP	23313552
MIRT684247	hsa-miR-4525	HITS-CLIP	23313552
MIRT684246	hsa-miR-5010-5p	HITS-CLIP	23313552
MIRT684245	hsa-miR-6512-3p	HITS-CLIP	23313552
MIRT684244	hsa-miR-6720-5p	HITS-CLIP	23313552
MIRT684243	hsa-miR-1275	HITS-CLIP	23313552
MIRT684242	hsa-miR-4665-5p	HITS-CLIP	23313552
MIRT639355	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT639354	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT639353	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT639352	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT639351	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT639350	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT639349	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT639348	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT639347	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT639346	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT639345	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT639344	hsa-miR-507	HITS-CLIP	23824327
MIRT639343	hsa-miR-557	HITS-CLIP	23824327
MIRT639342	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT466537	hsa-miR-3929	PAR-CLIP	23592263
MIRT466536	hsa-miR-4419b	PAR-CLIP	23592263
MIRT466535	hsa-miR-4478	PAR-CLIP	23592263
MIRT466534	hsa-miR-383-3p	PAR-CLIP	23592263
MIRT466533	hsa-miR-4679	PAR-CLIP	23592263
MIRT466532	hsa-miR-485-5p	PAR-CLIP	23592263
MIRT466531	hsa-miR-6884-5p	PAR-CLIP	23592263
MIRT466530	hsa-miR-214-5p	PAR-CLIP	23592263
MIRT466529	hsa-miR-6811-3p	PAR-CLIP	23592263
MIRT466528	hsa-miR-7160-5p	PAR-CLIP	23592263
MIRT466527	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT466526	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT466525	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT466524	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT466523	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT466522	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT466521	hsa-miR-203a-5p	PAR-CLIP	23592263
MIRT466520	hsa-miR-1206	PAR-CLIP	23592263
MIRT466519	hsa-miR-7977	PAR-CLIP	23592263
MIRT466518	hsa-miR-6514-3p	PAR-CLIP	23592263
MIRT466517	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT466516	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT466515	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT466514	hsa-miR-1273h-5p	PAR-CLIP	23592263
MIRT466513	hsa-miR-30b-3p	PAR-CLIP	23592263
MIRT466512	hsa-miR-3689a-3p	PAR-CLIP	23592263
MIRT466511	hsa-miR-3689b-3p	PAR-CLIP	23592263
MIRT466510	hsa-miR-3689c	PAR-CLIP	23592263
MIRT466509	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT466508	hsa-miR-6780a-5p	PAR-CLIP	23592263
MIRT466507	hsa-miR-450a-1-3p	PAR-CLIP	23592263
MIRT466506	hsa-miR-3122	PAR-CLIP	23592263
MIRT466505	hsa-miR-3913-5p	PAR-CLIP	23592263
MIRT466504	hsa-miR-887-5p	PAR-CLIP	23592263
MIRT466503	hsa-miR-6513-5p	PAR-CLIP	23592263
MIRT466502	hsa-miR-566	PAR-CLIP	23592263
MIRT466501	hsa-miR-665	PAR-CLIP	23592263
MIRT1415333	hsa-miR-138	CLIP-seq
MIRT1415334	hsa-miR-1827	CLIP-seq
MIRT1415335	hsa-miR-2114	CLIP-seq
MIRT1415336	hsa-miR-2467-5p	CLIP-seq
MIRT1415337	hsa-miR-3160-3p	CLIP-seq
MIRT1415338	hsa-miR-3188	CLIP-seq
MIRT1415339	hsa-miR-3622a-3p	CLIP-seq
MIRT1415340	hsa-miR-3622b-3p	CLIP-seq
MIRT1415341	hsa-miR-3664-3p	CLIP-seq
MIRT1415342	hsa-miR-3689d	CLIP-seq
MIRT1415343	hsa-miR-3926	CLIP-seq
MIRT1415344	hsa-miR-3975	CLIP-seq
MIRT1415345	hsa-miR-4252	CLIP-seq
MIRT1415346	hsa-miR-4299	CLIP-seq
MIRT1415347	hsa-miR-4433	CLIP-seq
MIRT1415348	hsa-miR-4459	CLIP-seq
MIRT1415349	hsa-miR-4487	CLIP-seq
MIRT1415350	hsa-miR-4649-3p	CLIP-seq
MIRT1415351	hsa-miR-4693-3p	CLIP-seq
MIRT1415352	hsa-miR-4695-5p	CLIP-seq
MIRT1415353	hsa-miR-4722-5p	CLIP-seq
MIRT1415354	hsa-miR-4768-3p	CLIP-seq
MIRT1415355	hsa-miR-4793-3p	CLIP-seq
MIRT1415356	hsa-miR-510	CLIP-seq
MIRT1415357	hsa-miR-512-5p	CLIP-seq
MIRT1415358	hsa-miR-520f	CLIP-seq
MIRT1415359	hsa-miR-544b	CLIP-seq
MIRT1415360	hsa-miR-548s	CLIP-seq
MIRT1415361	hsa-miR-558	CLIP-seq
MIRT1415362	hsa-miR-625	CLIP-seq
MIRT1415363	hsa-miR-636	CLIP-seq
MIRT1415364	hsa-miR-766	CLIP-seq
MIRT1415365	hsa-miR-940	CLIP-seq
MIRT1415337	hsa-miR-3160-3p	CLIP-seq
MIRT1415342	hsa-miR-3689d	CLIP-seq
MIRT1415349	hsa-miR-4487	CLIP-seq
MIRT1415361	hsa-miR-558	CLIP-seq
MIRT1415333	hsa-miR-138	CLIP-seq
MIRT1415334	hsa-miR-1827	CLIP-seq
MIRT1415337	hsa-miR-3160-3p	CLIP-seq
MIRT1415342	hsa-miR-3689d	CLIP-seq
MIRT1415343	hsa-miR-3926	CLIP-seq
MIRT1415345	hsa-miR-4252	CLIP-seq
MIRT1415346	hsa-miR-4299	CLIP-seq
MIRT1415347	hsa-miR-4433	CLIP-seq
MIRT1415348	hsa-miR-4459	CLIP-seq
MIRT1415349	hsa-miR-4487	CLIP-seq
MIRT1415350	hsa-miR-4649-3p	CLIP-seq
MIRT1415353	hsa-miR-4722-5p	CLIP-seq
MIRT1415354	hsa-miR-4768-3p	CLIP-seq
MIRT1415355	hsa-miR-4793-3p	CLIP-seq
MIRT1415359	hsa-miR-544b	CLIP-seq
MIRT1415360	hsa-miR-548s	CLIP-seq
MIRT1415361	hsa-miR-558	CLIP-seq
MIRT1415362	hsa-miR-625	CLIP-seq
MIRT1415364	hsa-miR-766	CLIP-seq
MIRT1415365	hsa-miR-940	CLIP-seq
MIRT1415333	hsa-miR-138	CLIP-seq
MIRT1415334	hsa-miR-1827	CLIP-seq
MIRT1415336	hsa-miR-2467-5p	CLIP-seq
MIRT1415337	hsa-miR-3160-3p	CLIP-seq
MIRT1415338	hsa-miR-3188	CLIP-seq
MIRT1415339	hsa-miR-3622a-3p	CLIP-seq
MIRT1415340	hsa-miR-3622b-3p	CLIP-seq
MIRT1415341	hsa-miR-3664-3p	CLIP-seq
MIRT1415342	hsa-miR-3689d	CLIP-seq
MIRT1415343	hsa-miR-3926	CLIP-seq
MIRT1415344	hsa-miR-3975	CLIP-seq
MIRT1415345	hsa-miR-4252	CLIP-seq
MIRT1415346	hsa-miR-4299	CLIP-seq
MIRT1415347	hsa-miR-4433	CLIP-seq
MIRT1415348	hsa-miR-4459	CLIP-seq
MIRT1415349	hsa-miR-4487	CLIP-seq
MIRT1415350	hsa-miR-4649-3p	CLIP-seq
MIRT1415352	hsa-miR-4695-5p	CLIP-seq
MIRT1415353	hsa-miR-4722-5p	CLIP-seq
MIRT1415354	hsa-miR-4768-3p	CLIP-seq
MIRT1415355	hsa-miR-4793-3p	CLIP-seq
MIRT1415356	hsa-miR-510	CLIP-seq
MIRT1415357	hsa-miR-512-5p	CLIP-seq
MIRT1415359	hsa-miR-544b	CLIP-seq
MIRT1415360	hsa-miR-548s	CLIP-seq
MIRT1415361	hsa-miR-558	CLIP-seq
MIRT1415362	hsa-miR-625	CLIP-seq
MIRT1415364	hsa-miR-766	CLIP-seq
MIRT1415365	hsa-miR-940	CLIP-seq
MIRT1415334	hsa-miR-1827	CLIP-seq
MIRT1415350	hsa-miR-4649-3p	CLIP-seq
MIRT1415353	hsa-miR-4722-5p	CLIP-seq
MIRT1415354	hsa-miR-4768-3p	CLIP-seq
MIRT1415365	hsa-miR-940	CLIP-seq
MIRT1415334	hsa-miR-1827	CLIP-seq
MIRT1415337	hsa-miR-3160-3p	CLIP-seq
MIRT1415342	hsa-miR-3689d	CLIP-seq
MIRT1415349	hsa-miR-4487	CLIP-seq
MIRT1415350	hsa-miR-4649-3p	CLIP-seq
MIRT1415353	hsa-miR-4722-5p	CLIP-seq
MIRT1415354	hsa-miR-4768-3p	CLIP-seq
MIRT1415361	hsa-miR-558	CLIP-seq
MIRT1415365	hsa-miR-940	CLIP-seq
MIRT2466211	hsa-miR-1268	CLIP-seq
MIRT2466212	hsa-miR-1268b	CLIP-seq
MIRT1415350	hsa-miR-4649-3p	CLIP-seq
MIRT2466213	hsa-miR-548c-3p	CLIP-seq
MIRT2466211	hsa-miR-1268	CLIP-seq
MIRT2466212	hsa-miR-1268b	CLIP-seq
MIRT1415333	hsa-miR-138	CLIP-seq
MIRT1415334	hsa-miR-1827	CLIP-seq
MIRT1415335	hsa-miR-2114	CLIP-seq
MIRT1415336	hsa-miR-2467-5p	CLIP-seq
MIRT1415337	hsa-miR-3160-3p	CLIP-seq
MIRT1415338	hsa-miR-3188	CLIP-seq
MIRT1415341	hsa-miR-3664-3p	CLIP-seq
MIRT1415342	hsa-miR-3689d	CLIP-seq
MIRT1415344	hsa-miR-3975	CLIP-seq
MIRT1415345	hsa-miR-4252	CLIP-seq
MIRT1415347	hsa-miR-4433	CLIP-seq
MIRT1415348	hsa-miR-4459	CLIP-seq
MIRT1415349	hsa-miR-4487	CLIP-seq
MIRT2639669	hsa-miR-4634	CLIP-seq
MIRT1415350	hsa-miR-4649-3p	CLIP-seq
MIRT2639670	hsa-miR-4684-5p	CLIP-seq
MIRT1415352	hsa-miR-4695-5p	CLIP-seq
MIRT1415353	hsa-miR-4722-5p	CLIP-seq
MIRT1415354	hsa-miR-4768-3p	CLIP-seq
MIRT2639671	hsa-miR-4783-5p	CLIP-seq
MIRT1415355	hsa-miR-4793-3p	CLIP-seq
MIRT1415356	hsa-miR-510	CLIP-seq
MIRT1415357	hsa-miR-512-5p	CLIP-seq
MIRT2466213	hsa-miR-548c-3p	CLIP-seq
MIRT1415361	hsa-miR-558	CLIP-seq
MIRT1415362	hsa-miR-625	CLIP-seq
MIRT1415364	hsa-miR-766	CLIP-seq
MIRT1415365	hsa-miR-940	CLIP-seq
MIRT2466211	hsa-miR-1268	CLIP-seq
MIRT2466212	hsa-miR-1268b	CLIP-seq
MIRT1415333	hsa-miR-138	CLIP-seq
MIRT1415334	hsa-miR-1827	CLIP-seq
MIRT1415335	hsa-miR-2114	CLIP-seq
MIRT1415336	hsa-miR-2467-5p	CLIP-seq
MIRT1415337	hsa-miR-3160-3p	CLIP-seq
MIRT1415338	hsa-miR-3188	CLIP-seq
MIRT1415342	hsa-miR-3689d	CLIP-seq
MIRT1415344	hsa-miR-3975	CLIP-seq
MIRT1415345	hsa-miR-4252	CLIP-seq
MIRT1415346	hsa-miR-4299	CLIP-seq
MIRT1415349	hsa-miR-4487	CLIP-seq
MIRT2639669	hsa-miR-4634	CLIP-seq
MIRT1415350	hsa-miR-4649-3p	CLIP-seq
MIRT2639670	hsa-miR-4684-5p	CLIP-seq
MIRT1415353	hsa-miR-4722-5p	CLIP-seq
MIRT1415354	hsa-miR-4768-3p	CLIP-seq
MIRT2639671	hsa-miR-4783-5p	CLIP-seq
MIRT1415355	hsa-miR-4793-3p	CLIP-seq
MIRT2466213	hsa-miR-548c-3p	CLIP-seq
MIRT1415361	hsa-miR-558	CLIP-seq
MIRT1415362	hsa-miR-625	CLIP-seq
MIRT1415364	hsa-miR-766	CLIP-seq
MIRT1415365	hsa-miR-940	CLIP-seq

Show/Hide all (6)

Transcription factor	Regulation	Reference
EGR1	Unknown	18698092
ETS1	Activation	18698092
GATA1	Activation	18698092
NFE2	Unknown	18698092
SP1	Unknown	18698092
WT1	Repression	19067769

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004960	Function	Thromboxane receptor activity	IEA
GO:0004961	Function	Thromboxane A2 receptor activity	TAS	8119956
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	TAS
GO:0005515	Function	Protein binding	IPI	17644091, 19464661, 20959415
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	1825698, 8119956
GO:0006939	Process	Smooth muscle contraction	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	1825698
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0016020	Component	Membrane	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0019229	Process	Regulation of vasoconstriction	IEA
GO:0030194	Process	Positive regulation of blood coagulation	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0033574	Process	Response to testosterone	IEA
GO:0038193	Process	Thromboxane A2 signaling pathway	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045777	Process	Positive regulation of blood pressure	IBA
GO:0045777	Process	Positive regulation of blood pressure	IEA
GO:0045907	Process	Positive regulation of vasoconstriction	IBA
GO:0045907	Process	Positive regulation of vasoconstriction	IEA
GO:0045987	Process	Positive regulation of smooth muscle contraction	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0090051	Process	Negative regulation of cell migration involved in sprouting angiogenesis	IGI	24558106

MIM	HGNC	e!Ensembl
188070	11608	ENSG00000006638

P21731

Protein name

Thromboxane A2 receptor (TXA2-R) (Prostanoid TP receptor)

Protein function

Receptor for thromboxane A2 (TXA2), a potent stimulator of platelet aggregation. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. In the kidney, the binding of TXA2 t

PDB

8XJN , 8XJO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	41 → 308	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL
LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG
SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE
VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN
QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ

Sequence length

343

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway Neuroactive ligand-receptor interaction Platelet activation		Prostanoid ligand receptors G alpha (q) signalling events G alpha (12/13) signalling events Thromboxane signalling through TP receptor

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Abnormal platelet aggregation	Likely pathogenic	rs1599869510	RCV000851879	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Bleeding disorder, platelet-type, 13, susceptibility to	Likely pathogenic	rs1363883059	RCV002245478	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Asthma	Benign	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
ASTHMA, ASPIRIN-INDUCED	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLEEDING DIATHESIS DUE TO THROMBOXANE SYNTHESIS DEFICIENCY	—	GenCC, Orphanet GenCC, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLEEDING DISORDER DUE TO DEFECTIVE THROMBOXANE A2 RECEPTOR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLOOD PLATELET DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHAGIC DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Impaired thromboxane A2 agonist-induced platelet aggregation	Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TBXA2R-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (65)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	16156795, 16499875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	23279270	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	19403042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30985753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10830912, 12000493, 15805995, 15898979, 17496729, 18031559, 20395963, 22017802, 23517037, 27058349		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Asthma	Asthma	Pubtator	15898979, 36936944, 37231900	Associate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Asthma, Aspirin-Induced	Asthma	BEFREE	16502481		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma, Aspirin-Induced	Asthma	CTD_human_DG	16502481, 20485159		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	8632356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	15898979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30985753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bleeding diathesis due to thromboxane synthesis deficiency	Bleeding Disorder	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bleeding Disorder due to Defective Thromboxane A2 Receptor	Bleeding Disorder	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	19828703, 7929844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet-type bleeding disorder	CTD_human_DG	19828703, 7929844		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blood Platelet Disorders	Platelet disorder	Pubtator	23279270, 24465800, 27641736, 28704403, 31389738, 32723322	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blood Platelet Disorders	Platelet disorder	Pubtator	31389738	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	27487152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19570744, 23475608, 24115277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	24465800, 32723322, 35236104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	28704403, 30914039	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	17249521, 19403042, 23456445, 25557379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	LHGDN	17249521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	19403042, 27641736, 28704403, 30914039	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	20395963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary Aneurysm	BEFREE	30179800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	24558106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	11922633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	21070398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28513223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28513223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	21070398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Hemorrhage	Gastrointestinal hemorrhage	Pubtator	26830988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	24465800, 31389738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhagic Disorders	Hemorrhagic Disorders	CTD_human_DG	19828703		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	BEFREE	28415790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	24465800	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28942103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29138825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24747176, 27487152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19570744, 23475608, 24115277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27689401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22515524, 23349788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	30179800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	26724804	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	7965765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	15898979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	15898979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22515524, 24115277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	24747176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	29620149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23688183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	31969157	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27689401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18172303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21357687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Thromboembolisms	Pulmonary thromboembolism	CTD_human_DG	7740511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	CTD_human_DG	12167471		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhinitis	Rhinitis	BEFREE	22017802		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31969157	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytopenia 1	Thrombocytopenia	Pubtator	31389738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	24465800, 32467143, 39798965	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27487152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27487152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	35236104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TBXA2R (thromboxane A2 receptor)