Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	6902
Gene name	Tubulin folding cofactor A
Gene symbol	TBCA
Synonyms (NCBI Gene)	-
Chromosome	5
Chromosome location	5q14.1
Summary	The product of this gene is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubuli

Show/Hide all (82)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001495	hsa-miR-155-5p	pSILAC	18668040
MIRT001495	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT001495	hsa-miR-155-5p	Proteomics	18668040
MIRT664211	hsa-miR-3156-5p	HITS-CLIP	23824327
MIRT664210	hsa-miR-4733-5p	HITS-CLIP	23824327
MIRT664209	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT664208	hsa-miR-494-3p	HITS-CLIP	23824327
MIRT664207	hsa-miR-510-3p	HITS-CLIP	23824327
MIRT664206	hsa-miR-1264	HITS-CLIP	23824327
MIRT664205	hsa-miR-1250-3p	HITS-CLIP	23824327
MIRT664204	hsa-miR-3691-3p	HITS-CLIP	23824327
MIRT664203	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT664202	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT664201	hsa-miR-103a-2-5p	HITS-CLIP	23824327
MIRT664200	hsa-miR-5696	HITS-CLIP	23824327
MIRT664199	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT664198	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT664197	hsa-miR-3685	HITS-CLIP	23824327
MIRT664196	hsa-miR-384	HITS-CLIP	23824327
MIRT664195	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT664194	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT648181	hsa-miR-186-5p	HITS-CLIP	23824327
MIRT648180	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT664211	hsa-miR-3156-5p	HITS-CLIP	23824327
MIRT664210	hsa-miR-4733-5p	HITS-CLIP	23824327
MIRT664209	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT664208	hsa-miR-494-3p	HITS-CLIP	23824327
MIRT664207	hsa-miR-510-3p	HITS-CLIP	23824327
MIRT664206	hsa-miR-1264	HITS-CLIP	23824327
MIRT664205	hsa-miR-1250-3p	HITS-CLIP	23824327
MIRT664204	hsa-miR-3691-3p	HITS-CLIP	23824327
MIRT664203	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT664202	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT664201	hsa-miR-103a-2-5p	HITS-CLIP	23824327
MIRT664200	hsa-miR-5696	HITS-CLIP	23824327
MIRT664199	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT664198	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT664197	hsa-miR-3685	HITS-CLIP	23824327
MIRT664196	hsa-miR-384	HITS-CLIP	23824327
MIRT664195	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT664194	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT648181	hsa-miR-186-5p	HITS-CLIP	23824327
MIRT648180	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT1413941	hsa-miR-23a	CLIP-seq
MIRT1413942	hsa-miR-23b	CLIP-seq
MIRT1413943	hsa-miR-23c	CLIP-seq
MIRT1413944	hsa-miR-380	CLIP-seq
MIRT1413945	hsa-miR-4495	CLIP-seq
MIRT1413946	hsa-miR-4705	CLIP-seq
MIRT1413947	hsa-miR-548ac	CLIP-seq
MIRT1413948	hsa-miR-548ae	CLIP-seq
MIRT1413949	hsa-miR-548aj	CLIP-seq
MIRT1413950	hsa-miR-548am	CLIP-seq
MIRT1413951	hsa-miR-548d-3p	CLIP-seq
MIRT1413952	hsa-miR-548x	CLIP-seq
MIRT1413953	hsa-miR-548z	CLIP-seq
MIRT1413954	hsa-miR-577	CLIP-seq
MIRT2124216	hsa-miR-155	CLIP-seq
MIRT2346532	hsa-miR-1246	CLIP-seq
MIRT2124216	hsa-miR-155	CLIP-seq
MIRT1413941	hsa-miR-23a	CLIP-seq
MIRT1413942	hsa-miR-23b	CLIP-seq
MIRT1413943	hsa-miR-23c	CLIP-seq
MIRT2346533	hsa-miR-3662	CLIP-seq
MIRT1413944	hsa-miR-380	CLIP-seq
MIRT2346534	hsa-miR-4274	CLIP-seq
MIRT1413945	hsa-miR-4495	CLIP-seq
MIRT2346535	hsa-miR-4519	CLIP-seq
MIRT2346536	hsa-miR-4694-3p	CLIP-seq
MIRT1413946	hsa-miR-4705	CLIP-seq
MIRT2346537	hsa-miR-4789-3p	CLIP-seq
MIRT2346538	hsa-miR-508-3p	CLIP-seq
MIRT2346539	hsa-miR-548aa	CLIP-seq
MIRT1413947	hsa-miR-548ac	CLIP-seq
MIRT1413948	hsa-miR-548ae	CLIP-seq
MIRT1413949	hsa-miR-548aj	CLIP-seq
MIRT1413950	hsa-miR-548am	CLIP-seq
MIRT1413951	hsa-miR-548d-3p	CLIP-seq
MIRT1413952	hsa-miR-548x	CLIP-seq
MIRT1413953	hsa-miR-548z	CLIP-seq
MIRT1413954	hsa-miR-577	CLIP-seq
MIRT2346540	hsa-miR-711	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22681889
GO:0005515	Function	Protein binding	IPI	21044950, 32353859, 33060197
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	TAS	8706133
GO:0007021	Process	Tubulin complex assembly	IBA
GO:0007021	Process	Tubulin complex assembly	IEA
GO:0007023	Process	Post-chaperonin tubulin folding pathway	IEA
GO:0007023	Process	Post-chaperonin tubulin folding pathway	TAS	8706133
GO:0015630	Component	Microtubule cytoskeleton	IBA
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0015631	Function	Tubulin binding	IBA
GO:0048487	Function	Beta-tubulin binding	IEA
GO:0051087	Function	Protein-folding chaperone binding	TAS	8706133

MIM	HGNC	e!Ensembl
610058	11579	ENSG00000171530

O75347

Protein name

Tubulin-specific chaperone A (TCP1-chaperonin cofactor A) (Tubulin-folding cofactor A) (CFA)

Protein function

Tubulin-folding protein; involved in the early step of the tubulin folding pathway.

PDB

1H7C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02970	TBCA	9 → 95	Tubulin binding cofactor A	Domain

Sequence

MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQES
RMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA

Sequence length

108

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARDIOMYOPATHY, HYPERTROPHIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (22)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	39392298	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	31128893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	24405551, 31834562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34557456	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	19939808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31106586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	23671420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disturbance in mood	Mood Disorder	BEFREE	28049104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	23671420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	CTD_human_DG	9527842		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	CTD_human_DG	9527842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31703407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31703407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31106586		★★★★★ ★☆☆☆☆ Found in Text Mining only
MUTYH-Associate Polyposis	Polyposis	BEFREE	30738572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31812677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	29746524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	19939808		★★★★★ ★☆☆☆☆ Found in Text Mining only
prostatitis	Prostatitis	BEFREE	28499240, 9317107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	29746524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30143947, 31003542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	BEFREE	30266771, 31676671		★★★★★ ★☆☆☆☆ Found in Text Mining only

TBCA (tubulin folding cofactor A)