Gene Gene information from NCBI Gene database.
Entrez ID 6887
Gene name TAL bHLH transcription factor 2
Gene symbol TAL2
Synonyms (NCBI Gene)
-
Chromosome 9
Chromosome location 9q31.2
Summary This intronless gene encodes a helix-loop-helix protein. Translocations between this gene on chromosome 9 and the T-cell receptor beta-chain locus on chromosome 7 have been associated with activation of the T-cell acute lymphocytic leukemia 2 gene and T-c
miRNA miRNA information provided by mirtarbase database.
51
miRTarBase ID miRNA Experiments Reference
MIRT723276 hsa-miR-1237-3p HITS-CLIP 19536157
MIRT723275 hsa-miR-1248 HITS-CLIP 19536157
MIRT723274 hsa-miR-130b-5p HITS-CLIP 19536157
MIRT723273 hsa-miR-3124-3p HITS-CLIP 19536157
MIRT723272 hsa-miR-627-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
186855 11557 ENSG00000186051
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q16559
Protein name T-cell acute lymphocytic leukemia protein 2 (TAL-2) (Class A basic helix-loop-helix protein 19) (bHLHa19)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH 3 55 Helix-loop-helix DNA-binding domain Domain
Sequence
MTRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGE
QSLQQTGVAAQGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHIP
Sequence length 108
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
LEUKEMIA, ACUTE LYMPHOBLASTIC HPO
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adult T-Cell Lymphoma/Leukemia T-Cell Lymphoma/Leukemia BEFREE 1763056, 9931488
★☆☆☆☆
Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia Lymphoblastic Leukemia CTD_human_DG
★☆☆☆☆
Found in Text Mining only
L2 Acute Lymphoblastic Leukemia Lymphoblastic Leukemia CTD_human_DG
★☆☆☆☆
Found in Text Mining only
Lung Neoplasms Lung neoplasms Pubtator 19088038 Associate
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 21971700
★☆☆☆☆
Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma Lymphoblastic Leukemia HPO_DG
★☆☆☆☆
Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma Lymphoblastic Leukemia CTD_human_DG
★☆☆☆☆
Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma Lymphoblastic Leukemia BEFREE 11781368, 1450410, 1763056, 8142619, 8152805
★☆☆☆☆
Found in Text Mining only