Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6883
Gene name	TATA-box binding protein associated factor 12
Gene symbol	TAF12
Synonyms (NCBI Gene)	TAF2JTAFII20
Chromosome	1
Chromosome location	1p35.3
Summary	Control of transcription by RNA polymerase II involves the basal transcription machinery which is a collection of proteins. These proteins with RNA polymerase II, assemble into complexes which are modulated by transactivator proteins that bind to cis-regu

117

Show/Hide all (117)

miRTarBase ID	miRNA	Experiments	Reference
MIRT040579	hsa-miR-92b-3p	CLASH	23622248
MIRT455602	hsa-miR-548av-5p	PAR-CLIP	23592263
MIRT455600	hsa-miR-548k	PAR-CLIP	23592263
MIRT455601	hsa-miR-8054	PAR-CLIP	23592263
MIRT455599	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT455598	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT455597	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT455595	hsa-miR-7515	PAR-CLIP	23592263
MIRT455596	hsa-miR-6124	PAR-CLIP	23592263
MIRT455594	hsa-miR-3202	PAR-CLIP	23592263
MIRT455593	hsa-miR-4434	PAR-CLIP	23592263
MIRT455592	hsa-miR-4516	PAR-CLIP	23592263
MIRT455591	hsa-miR-5703	PAR-CLIP	23592263
MIRT455590	hsa-miR-4668-5p	PAR-CLIP	23592263
MIRT455589	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT455588	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT455586	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT455587	hsa-miR-4271	PAR-CLIP	23592263
MIRT455585	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT455584	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT455602	hsa-miR-548av-5p	PAR-CLIP	23592263
MIRT455600	hsa-miR-548k	PAR-CLIP	23592263
MIRT455601	hsa-miR-8054	PAR-CLIP	23592263
MIRT455599	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT455598	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT455597	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT455595	hsa-miR-7515	PAR-CLIP	23592263
MIRT455596	hsa-miR-6124	PAR-CLIP	23592263
MIRT455594	hsa-miR-3202	PAR-CLIP	23592263
MIRT455593	hsa-miR-4434	PAR-CLIP	23592263
MIRT455592	hsa-miR-4516	PAR-CLIP	23592263
MIRT455591	hsa-miR-5703	PAR-CLIP	23592263
MIRT455590	hsa-miR-4668-5p	PAR-CLIP	23592263
MIRT455589	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT455588	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT455586	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT455587	hsa-miR-4271	PAR-CLIP	23592263
MIRT455585	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT455584	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT1408976	hsa-miR-1208	CLIP-seq
MIRT1408977	hsa-miR-1255a	CLIP-seq
MIRT1408978	hsa-miR-1255b	CLIP-seq
MIRT1408979	hsa-miR-1271	CLIP-seq
MIRT1408980	hsa-miR-1273f	CLIP-seq
MIRT1408981	hsa-miR-1297	CLIP-seq
MIRT1408982	hsa-miR-137	CLIP-seq
MIRT1408983	hsa-miR-143	CLIP-seq
MIRT1408984	hsa-miR-182	CLIP-seq
MIRT1408985	hsa-miR-2053	CLIP-seq
MIRT1408986	hsa-miR-26a	CLIP-seq
MIRT1408987	hsa-miR-26b	CLIP-seq
MIRT1408988	hsa-miR-3183	CLIP-seq
MIRT1408989	hsa-miR-4264	CLIP-seq
MIRT1408990	hsa-miR-4465	CLIP-seq
MIRT1408991	hsa-miR-4528	CLIP-seq
MIRT1408992	hsa-miR-4682	CLIP-seq
MIRT1408993	hsa-miR-4704-3p	CLIP-seq
MIRT1408994	hsa-miR-4708-5p	CLIP-seq
MIRT1408995	hsa-miR-4723-3p	CLIP-seq
MIRT1408996	hsa-miR-4770	CLIP-seq
MIRT1408997	hsa-miR-4793-3p	CLIP-seq
MIRT1408998	hsa-miR-4797-3p	CLIP-seq
MIRT1408999	hsa-miR-515-5p	CLIP-seq
MIRT1409000	hsa-miR-569	CLIP-seq
MIRT1409001	hsa-miR-96	CLIP-seq
MIRT1408977	hsa-miR-1255a	CLIP-seq
MIRT1408978	hsa-miR-1255b	CLIP-seq
MIRT1408980	hsa-miR-1273f	CLIP-seq
MIRT2345064	hsa-miR-1279	CLIP-seq
MIRT1408981	hsa-miR-1297	CLIP-seq
MIRT1408983	hsa-miR-143	CLIP-seq
MIRT1408986	hsa-miR-26a	CLIP-seq
MIRT1408987	hsa-miR-26b	CLIP-seq
MIRT2345065	hsa-miR-3148	CLIP-seq
MIRT2345066	hsa-miR-3646	CLIP-seq
MIRT2345067	hsa-miR-410	CLIP-seq
MIRT1408990	hsa-miR-4465	CLIP-seq
MIRT1408992	hsa-miR-4682	CLIP-seq
MIRT1408993	hsa-miR-4704-3p	CLIP-seq
MIRT1408994	hsa-miR-4708-5p	CLIP-seq
MIRT1408996	hsa-miR-4770	CLIP-seq
MIRT1408999	hsa-miR-515-5p	CLIP-seq
MIRT2345068	hsa-miR-520d-5p	CLIP-seq
MIRT2345069	hsa-miR-524-5p	CLIP-seq
MIRT2638151	hsa-miR-1252	CLIP-seq
MIRT2638152	hsa-miR-155	CLIP-seq
MIRT2638153	hsa-miR-200b	CLIP-seq
MIRT2638154	hsa-miR-200c	CLIP-seq
MIRT2638155	hsa-miR-2355-3p	CLIP-seq
MIRT2638156	hsa-miR-323-3p	CLIP-seq
MIRT2638157	hsa-miR-369-3p	CLIP-seq
MIRT2638158	hsa-miR-370	CLIP-seq
MIRT2638159	hsa-miR-374a	CLIP-seq
MIRT2638160	hsa-miR-374b	CLIP-seq
MIRT2638161	hsa-miR-3973	CLIP-seq
MIRT2345067	hsa-miR-410	CLIP-seq
MIRT2638162	hsa-miR-4261	CLIP-seq
MIRT2638163	hsa-miR-429	CLIP-seq
MIRT2638164	hsa-miR-4496	CLIP-seq
MIRT2638165	hsa-miR-4646-3p	CLIP-seq
MIRT1408993	hsa-miR-4704-3p	CLIP-seq
MIRT2345068	hsa-miR-520d-5p	CLIP-seq
MIRT2345069	hsa-miR-524-5p	CLIP-seq
MIRT2638151	hsa-miR-1252	CLIP-seq
MIRT2638152	hsa-miR-155	CLIP-seq
MIRT2638153	hsa-miR-200b	CLIP-seq
MIRT2638154	hsa-miR-200c	CLIP-seq
MIRT2638155	hsa-miR-2355-3p	CLIP-seq
MIRT2638156	hsa-miR-323-3p	CLIP-seq
MIRT2638158	hsa-miR-370	CLIP-seq
MIRT2638161	hsa-miR-3973	CLIP-seq
MIRT2638162	hsa-miR-4261	CLIP-seq
MIRT2638163	hsa-miR-429	CLIP-seq
MIRT2638164	hsa-miR-4496	CLIP-seq
MIRT2638165	hsa-miR-4646-3p	CLIP-seq
MIRT2345068	hsa-miR-520d-5p	CLIP-seq
MIRT2345069	hsa-miR-524-5p	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
ATF7	Activation	15735663
ETS1	Unknown	18567809

Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000124	Component	SAGA complex	IDA	9674425, 11564863
GO:0000124	Component	SAGA complex	IEA
GO:0000124	Component	SAGA complex	NAS	9674425, 19114550
GO:0003677	Function	DNA binding	IBA
GO:0003677	Function	DNA binding	IDA	15601843
GO:0003677	Function	DNA binding	IEA
GO:0003713	Function	Transcription coactivator activity	IDA	11564863, 17264123
GO:0005515	Function	Protein binding	IPI	7667268, 7729427, 9603525, 11438666, 12237304, 17158164, 17268553, 23292512, 25416956, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	EXP	23332750
GO:0005634	Component	Nucleus	IDA	11564863
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005669	Component	Transcription factor TFIID complex	IBA
GO:0005669	Component	Transcription factor TFIID complex	IDA	14580349, 29111974
GO:0005669	Component	Transcription factor TFIID complex	IEA
GO:0005669	Component	Transcription factor TFIID complex	IPI	23332750
GO:0005669	Component	Transcription factor TFIID complex	ISS
GO:0005669	Component	Transcription factor TFIID complex	TAS	7729427
GO:0006282	Process	Regulation of DNA repair	NAS	11406595, 11564863
GO:0006352	Process	DNA-templated transcription initiation	IDA	9603525
GO:0006352	Process	DNA-templated transcription initiation	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	17694077
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	9603525
GO:0006366	Process	Transcription by RNA polymerase II	TAS	7729427
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	IDA	9603525
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IDA	9603525
GO:0017025	Function	TBP-class protein binding	IBA
GO:0033276	Component	Transcription factor TFTC complex	IDA	9603525
GO:0033276	Component	Transcription factor TFTC complex	NAS	10373431
GO:0042789	Process	MRNA transcription by RNA polymerase II	IDA	17884155
GO:0043484	Process	Regulation of RNA splicing	NAS	11564863
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	18206972
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	17264123
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	IBA
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	IPI	27007846
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	ISS
GO:0060261	Process	Positive regulation of transcription initiation by RNA polymerase II	IDA	17884155
GO:0140297	Function	DNA-binding transcription factor binding	IDA	17264123
GO:0140297	Function	DNA-binding transcription factor binding	IPI	17264123

MIM	HGNC	e!Ensembl
600773	11545	ENSG00000120656

Q16514

Protein name

Transcription initiation factor TFIID subunit 12 (Transcription initiation factor TFIID 20/15 kDa subunits) (TAFII-20/TAFII-15) (TAFII20/TAFII15)

Protein function

The TFIID basal transcription factor complex plays a major role in the initiation of RNA polymerase II (Pol II)-dependent transcription (PubMed:33795473). TFIID recognizes and binds promoters with or without a TATA box via its subunit TBP, a TAT

PDB

1H3O , 6MZC , 6MZD , 6MZL , 6MZM , 7EDX , 7EG7 , 7EG8 , 7EG9 , 7EGA , 7EGB , 7EGC , 7EGD , 7EGE , 7EGF , 7EGG , 7EGI , 7EGJ , 7ENA , 7ENC , 7KTR , 7KTS , 8GXQ , 8GXS , 8H7G , 8WAK , 8WAL , 8WAN , 8WAO , 8WAP , 8WAQ , 8WAR , 8WAS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03847	TFIID_20kDa	59 → 126	Transcription initiation factor TFIID subunit A	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTK
KKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHL
ERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK

Sequence length

161

Interactions

View interactions

	KEGG		Reactome
	Basal transcription factors		RNA Polymerase II Pre-transcription Events Regulation of TP53 Activity through Phosphorylation RNA Polymerase II Promoter Escape RNA Polymerase II Transcription Pre-Initiation And Promoter Opening RNA Polymerase II Transcription Initiation RNA Polymerase II Transcription Initiation And Promoter Clearance

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (11)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	21344536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	27551064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18360708, 18567809	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36551275	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29316427		★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	21344536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17623797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	23426901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paget Disease	Paget disease	BEFREE	23426901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma Choroid Plexus	Choroid plexus papilloma	Pubtator	36551275	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	21344536		★★★★★ ★☆☆☆☆ Found in Text Mining only

TAF12 (TATA-box binding protein associated factor 12)