Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6881
Gene name	TATA-box binding protein associated factor 10
Gene symbol	TAF10
Synonyms (NCBI Gene)	TAF2ATAF2HTAFII30
Chromosome	11
Chromosome location	11p15.4
Summary	Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly,

Show/Hide all (29)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004657	hsa-miR-491-5p	Luciferase reporter assay	20065103
MIRT2122664	hsa-miR-138	CLIP-seq
MIRT2122665	hsa-miR-142-5p	CLIP-seq
MIRT2122666	hsa-miR-3144-5p	CLIP-seq
MIRT2122667	hsa-miR-3151	CLIP-seq
MIRT2122668	hsa-miR-3191	CLIP-seq
MIRT2122669	hsa-miR-3650	CLIP-seq
MIRT2122670	hsa-miR-4438	CLIP-seq
MIRT2122671	hsa-miR-4447	CLIP-seq
MIRT2122672	hsa-miR-4472	CLIP-seq
MIRT2122673	hsa-miR-4652-5p	CLIP-seq
MIRT2122674	hsa-miR-4795-3p	CLIP-seq
MIRT2122675	hsa-miR-561	CLIP-seq
MIRT2122676	hsa-miR-570	CLIP-seq
MIRT2122665	hsa-miR-142-5p	CLIP-seq
MIRT2122670	hsa-miR-4438	CLIP-seq
MIRT2122674	hsa-miR-4795-3p	CLIP-seq
MIRT2122675	hsa-miR-561	CLIP-seq
MIRT2122676	hsa-miR-570	CLIP-seq
MIRT2122665	hsa-miR-142-5p	CLIP-seq
MIRT2122670	hsa-miR-4438	CLIP-seq
MIRT2122674	hsa-miR-4795-3p	CLIP-seq
MIRT2122675	hsa-miR-561	CLIP-seq
MIRT2122676	hsa-miR-570	CLIP-seq
MIRT2122665	hsa-miR-142-5p	CLIP-seq
MIRT2122670	hsa-miR-4438	CLIP-seq
MIRT2122674	hsa-miR-4795-3p	CLIP-seq
MIRT2122675	hsa-miR-561	CLIP-seq
MIRT2122676	hsa-miR-570	CLIP-seq

Show/Hide all (64)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IEA
GO:0000124	Component	SAGA complex	IBA
GO:0000124	Component	SAGA complex	IDA	9674425, 11564863
GO:0000124	Component	SAGA complex	NAS	9674425, 19114550
GO:0001673	Component	Male germ cell nucleus	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001756	Process	Somitogenesis	IEA
GO:0001889	Process	Liver development	IEA
GO:0001892	Process	Embryonic placenta development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0004402	Function	Histone acetyltransferase activity	IDA	9674425
GO:0005515	Function	Protein binding	IPI	15870280
GO:0005515	Function	Protein binding	IPI	7729427, 11438666, 12762840, 15115762, 15870280, 16415881, 23292512, 24981860, 28514442
GO:0005634	Component	Nucleus	EXP	23332750
GO:0005634	Component	Nucleus	IDA	11564863, 15099517, 15870280, 25959397
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005669	Component	Transcription factor TFIID complex	IBA
GO:0005669	Component	Transcription factor TFIID complex	IDA	7729427, 7923369, 14580349, 15099517, 29111974
GO:0005669	Component	Transcription factor TFIID complex	IPI	23332750
GO:0005669	Component	Transcription factor TFIID complex	ISS
GO:0005737	Component	Cytoplasm	IDA	15870280
GO:0006282	Process	Regulation of DNA repair	NAS	11406595, 11564863
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006352	Process	DNA-templated transcription initiation	IDA	9212049, 9603525
GO:0006352	Process	DNA-templated transcription initiation	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	17694077
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	9603525
GO:0006366	Process	Transcription by RNA polymerase II	IC	7729427
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	IBA
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	IC	7729427
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	IDA	9603525
GO:0006915	Process	Apoptotic process	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IBA
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IDA	9603525
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IDA	11564863
GO:0019899	Function	Enzyme binding	IPI	16415881
GO:0030331	Function	Nuclear estrogen receptor binding	IDA	7923369
GO:0033276	Component	Transcription factor TFTC complex	IDA	9603525, 10373431
GO:0033276	Component	Transcription factor TFTC complex	NAS	10373431
GO:0035264	Process	Multicellular organism growth	IEA
GO:0036285	Process	SAGA complex assembly	IEA
GO:0042789	Process	MRNA transcription by RNA polymerase II	IDA	17884155
GO:0042802	Function	Identical protein binding	IPI	7923369
GO:0043484	Process	Regulation of RNA splicing	NAS	11564863
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	18206972
GO:0048371	Process	Lateral mesodermal cell differentiation	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	15870280
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	IEA
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	IPI	27007846
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	ISS
GO:0060173	Process	Limb development	IEA
GO:0060261	Process	Positive regulation of transcription initiation by RNA polymerase II	IDA	17884155
GO:0065003	Process	Protein-containing complex assembly	IEA
GO:0070063	Function	RNA polymerase binding	IDA	15099517
GO:0070365	Process	Hepatocyte differentiation	IEA
GO:0097550	Component	Transcription preinitiation complex	IEA
GO:1905069	Process	Allantois development	IEA
GO:1990841	Function	Promoter-specific chromatin binding	IBA
GO:1990841	Function	Promoter-specific chromatin binding	IEA

MIM	HGNC	e!Ensembl
600475	11543	ENSG00000166337

Q12962

Protein name

Transcription initiation factor TFIID subunit 10 (STAF28) (Transcription initiation factor TFIID 30 kDa subunit) (TAF(II)30) (TAFII-30) (TAFII30)

Protein function

The TFIID basal transcription factor complex plays a major role in the initiation of RNA polymerase II (Pol II)-dependent transcription (PubMed:33795473). TFIID recognizes and binds promoters with or without a TATA box via its subunit TBP, a TAT

PDB

2F69 , 3M53 , 3M54 , 3M55 , 3M56 , 3M57 , 3M58 , 3M59 , 3M5A , 4J7F , 4J7I , 4J83 , 4J8O , 4WV4 , 5EG2 , 6MZC , 6MZD , 6MZL , 6MZM , 7EDX , 7EG7 , 7EG8 , 7EG9 , 7EGA , 7EGB , 7EGC , 7EGD , 7EGE , 7EGF , 7EGG , 7EGI , 7EGJ , 7ENA , 7ENC , 7KTR , 7KTS , 8GXQ , 8GXS , 8H7G , 8WAK , 8WAL , 8WAN , 8WAO , 8WAP , 8WAQ , 8WAR , 8WAS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03540	TFIID_30kDa	128 → 177	Transcription initiation factor TFIID 23-30kDa subunit	Family

Sequence

MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGG
TGPLAARAGEPAERRGAAPVSAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFL
MQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTA
SGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT

Sequence length

218

Interactions

View interactions

	KEGG		Reactome
	Basal transcription factors		Ub-specific processing proteases RNA Polymerase II Pre-transcription Events Regulation of TP53 Activity through Phosphorylation RNA Polymerase II Promoter Escape RNA Polymerase II Transcription Pre-Initiation And Promoter Opening RNA Polymerase II Transcription Initiation RNA Polymerase II Transcription Initiation And Promoter Clearance

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARDIOMYOPATHY, DILATED	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, HYPERTROPHIC, FAMILIAL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LONG QT SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Metabolic Syndrome	Metabolic syndrome	Pubtator	37960960	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	37960960	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TAF10 (TATA-box binding protein associated factor 10)