Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6880
Gene name	TATA-box binding protein associated factor 9
Gene symbol	TAF9
Synonyms (NCBI Gene)	MGC:5067STAF31/32TAF2GTAFII-31TAFII-32TAFII31TAFII32TAFIID32
Chromosome	5
Chromosome location	5q13.2
Summary	Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly,

Show/Hide all (75)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016116	hsa-miR-421	Sequencing	20371350
MIRT029623	hsa-miR-26b-5p	Microarray	19088304
MIRT031755	hsa-miR-16-5p	Proteomics	18668040
MIRT032332	hsa-let-7b-5p	Proteomics	18668040
MIRT040985	hsa-miR-505-3p	CLASH	23622248
MIRT1409954	hsa-miR-181a	CLIP-seq
MIRT1409955	hsa-miR-181b	CLIP-seq
MIRT1409956	hsa-miR-181c	CLIP-seq
MIRT1409957	hsa-miR-181d	CLIP-seq
MIRT1409958	hsa-miR-3074-3p	CLIP-seq
MIRT1409959	hsa-miR-3929	CLIP-seq
MIRT1409960	hsa-miR-4262	CLIP-seq
MIRT1409961	hsa-miR-4291	CLIP-seq
MIRT1409962	hsa-miR-4419b	CLIP-seq
MIRT1409963	hsa-miR-4452	CLIP-seq
MIRT1409964	hsa-miR-4477b	CLIP-seq
MIRT1409965	hsa-miR-4478	CLIP-seq
MIRT1409966	hsa-miR-4502	CLIP-seq
MIRT1409967	hsa-miR-4666-5p	CLIP-seq
MIRT1409968	hsa-miR-545	CLIP-seq
MIRT1409969	hsa-miR-600	CLIP-seq
MIRT1409970	hsa-miR-889	CLIP-seq
MIRT1409971	hsa-miR-200b	CLIP-seq
MIRT1409972	hsa-miR-200c	CLIP-seq
MIRT1409973	hsa-miR-3160-5p	CLIP-seq
MIRT1409974	hsa-miR-369-3p	CLIP-seq
MIRT1409975	hsa-miR-429	CLIP-seq
MIRT1409976	hsa-miR-4528	CLIP-seq
MIRT1409977	hsa-miR-490-5p	CLIP-seq
MIRT1409978	hsa-miR-500a	CLIP-seq
MIRT1409979	hsa-miR-664	CLIP-seq
MIRT2122834	hsa-miR-1272	CLIP-seq
MIRT2122835	hsa-miR-1322	CLIP-seq
MIRT2122836	hsa-miR-2964a-5p	CLIP-seq
MIRT2122837	hsa-miR-3117-5p	CLIP-seq
MIRT2122838	hsa-miR-4434	CLIP-seq
MIRT2122839	hsa-miR-4516	CLIP-seq
MIRT2122840	hsa-miR-4531	CLIP-seq
MIRT2122841	hsa-miR-4756-3p	CLIP-seq
MIRT1409977	hsa-miR-490-5p	CLIP-seq
MIRT2122834	hsa-miR-1272	CLIP-seq
MIRT2122835	hsa-miR-1322	CLIP-seq
MIRT2345230	hsa-miR-142-5p	CLIP-seq
MIRT2122836	hsa-miR-2964a-5p	CLIP-seq
MIRT2122837	hsa-miR-3117-5p	CLIP-seq
MIRT2122841	hsa-miR-4756-3p	CLIP-seq
MIRT2122834	hsa-miR-1272	CLIP-seq
MIRT2122835	hsa-miR-1322	CLIP-seq
MIRT2122836	hsa-miR-2964a-5p	CLIP-seq
MIRT2122837	hsa-miR-3117-5p	CLIP-seq
MIRT2122841	hsa-miR-4756-3p	CLIP-seq
MIRT2122834	hsa-miR-1272	CLIP-seq
MIRT2122835	hsa-miR-1322	CLIP-seq
MIRT2122836	hsa-miR-2964a-5p	CLIP-seq
MIRT2638256	hsa-miR-3065-5p	CLIP-seq
MIRT2122837	hsa-miR-3117-5p	CLIP-seq
MIRT2638257	hsa-miR-3614-3p	CLIP-seq
MIRT2638258	hsa-miR-4477a	CLIP-seq
MIRT1409976	hsa-miR-4528	CLIP-seq
MIRT2122841	hsa-miR-4756-3p	CLIP-seq
MIRT2638259	hsa-miR-4765	CLIP-seq
MIRT2638260	hsa-miR-562	CLIP-seq
MIRT1409979	hsa-miR-664	CLIP-seq
MIRT2122834	hsa-miR-1272	CLIP-seq
MIRT2122835	hsa-miR-1322	CLIP-seq
MIRT2122836	hsa-miR-2964a-5p	CLIP-seq
MIRT2638256	hsa-miR-3065-5p	CLIP-seq
MIRT2122837	hsa-miR-3117-5p	CLIP-seq
MIRT2638257	hsa-miR-3614-3p	CLIP-seq
MIRT2638258	hsa-miR-4477a	CLIP-seq
MIRT1409976	hsa-miR-4528	CLIP-seq
MIRT2122841	hsa-miR-4756-3p	CLIP-seq
MIRT2638259	hsa-miR-4765	CLIP-seq
MIRT2638260	hsa-miR-562	CLIP-seq
MIRT1409979	hsa-miR-664	CLIP-seq

Show/Hide all (58)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000124	Component	SAGA complex	IBA
GO:0000124	Component	SAGA complex	IDA	9674425, 11564863
GO:0000124	Component	SAGA complex	NAS	9674425, 19114550
GO:0000492	Process	Box C/D snoRNP assembly	IDA	17636026
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	19251649
GO:0002039	Function	P53 binding	IPI	11278372
GO:0003677	Function	DNA binding	IDA	15601843
GO:0003677	Function	DNA binding	IEA
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003713	Function	Transcription coactivator activity	IDA	11564863
GO:0003713	Function	Transcription coactivator activity	IMP	11278372
GO:0004402	Function	Histone acetyltransferase activity	IDA	9674425
GO:0005515	Function	Protein binding	IPI	7667268, 9045704, 9674425, 15489227, 15601843, 15899866, 16189514, 16713569, 17636026, 19251649, 21516116, 25416956, 32296183, 33961781
GO:0005634	Component	Nucleus	EXP	23332750
GO:0005634	Component	Nucleus	IDA	11564863
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005669	Component	Transcription factor TFIID complex	IBA
GO:0005669	Component	Transcription factor TFIID complex	IDA	14580349, 15899866, 29111974
GO:0005669	Component	Transcription factor TFIID complex	IEA
GO:0005669	Component	Transcription factor TFIID complex	IPI	23332750
GO:0005669	Component	Transcription factor TFIID complex	ISS
GO:0006282	Process	Regulation of DNA repair	NAS	11406595, 11564863
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006352	Process	DNA-templated transcription initiation	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	17694077
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	9603525
GO:0006974	Process	DNA damage response	IC	11278372
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IBA
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IC	29111974
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IEA
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	11278372
GO:0033276	Component	Transcription factor TFTC complex	IBA
GO:0033276	Component	Transcription factor TFTC complex	IDA	15899866
GO:0033276	Component	Transcription factor TFTC complex	IEA
GO:0033276	Component	Transcription factor TFTC complex	NAS	10373431
GO:0042789	Process	MRNA transcription by RNA polymerase II	IDA	17884155
GO:0043066	Process	Negative regulation of apoptotic process	IMP	15899866
GO:0043484	Process	Regulation of RNA splicing	NAS	11564863
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	18206972
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	11278372
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0050821	Process	Protein stabilization	IDA	15899866
GO:0051117	Function	ATPase binding	IPI	17636026
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	IBA
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	IPI	27007846
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	ISS
GO:0060261	Process	Positive regulation of transcription initiation by RNA polymerase II	IDA	17884155
GO:0060760	Process	Positive regulation of response to cytokine stimulus	IMP	15489227
GO:0070555	Process	Response to interleukin-1	IMP	15489227
GO:0070742	Function	C2H2 zinc finger domain binding	IPI	19251649
GO:0070761	Component	Pre-snoRNP complex	IDA	17636026
GO:0071339	Component	MLL1 complex	IDA	15960975
GO:0140297	Function	DNA-binding transcription factor binding	IPI	9171108, 19251649
GO:1902166	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IC	15899866
GO:1902166	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IEA

MIM	HGNC	e!Ensembl
600822	11542	ENSG00000273841

Q16594

Protein name

Transcription initiation factor TFIID subunit 9 (RNA polymerase II TBP-associated factor subunit G) (STAF31/32) (Transcription initiation factor TFIID 31 kDa subunit) (TAFII-31) (TAFII31) (Transcription initiation factor TFIID 32 kDa subunit) (TAFII-32) (

Protein function

The TFIID basal transcription factor complex plays a major role in the initiation of RNA polymerase II (Pol II)-dependent transcription (PubMed:33795473). TFIID recognizes and binds promoters with or without a TATA box via its subunit TBP, a TAT

PDB

6F3T , 6MZC , 6MZD , 6MZL , 6MZM , 7EDX , 7EG7 , 7EG8 , 7EG9 , 7EGA , 7EGB , 7EGC , 7EGD , 7EGE , 7EGF , 7EGG , 7EGI , 7EGJ , 7ENA , 7ENC , 8GXQ , 8GXS , 8H7G , 8WAK , 8WAL , 8WAN , 8WAO , 8WAP , 8WAQ , 8WAR , 8WAS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02291	TFIID-31kDa	9 → 130	Transcription initiation factor IID, 31kD subunit	Domain

Sequence

MESGKTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSH
AKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRY
CLTAPNYRLKSLQKKASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPM
SLTGQRFTVQMPTSQSPAVKASIPATSAVQNVLINPSLIGSKNILITTNMMSSQNTANES
SNALKRKREDDDDDDDDDDDYDNL

Sequence length

264

Interactions

View interactions

	KEGG		Reactome
	Basal transcription factors		RNA Polymerase II Pre-transcription Events Regulation of TP53 Activity through Phosphorylation RNA polymerase II transcribes snRNA genes RNA Polymerase II Promoter Escape RNA Polymerase II Transcription Pre-Initiation And Promoter Opening RNA Polymerase II Transcription Initiation RNA Polymerase II Transcription Initiation And Promoter Clearance

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
beta Thalassemia	Beta thalassemia	Pubtator	19251649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33739118	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33411682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	34257547	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23567350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	29257297		★★★★★ ★☆☆☆☆ Found in Text Mining only

TAF9 (TATA-box binding protein associated factor 9)