Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	688
Gene name	KLF transcription factor 5
Gene symbol	KLF5
Synonyms (NCBI Gene)	BTEB2CKLFIKLF
Chromosome	13
Chromosome location	13q22.1
Summary	This gene encodes a member of the Kruppel-like factor subfamily of zinc finger proteins. The encoded protein is a transcriptional activator that binds directly to a specific recognition motif in the promoters of target genes. This protein acts downstream

201

Show/Hide all (201)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001812	hsa-miR-141-3p	Luciferase reporter assay	15131085
MIRT021472	hsa-miR-9-5p	Microarray	17612493
MIRT001812	hsa-miR-141-3p	Reporter assay;Other	15131085
MIRT022040	hsa-miR-128-3p	Microarray	17612493
MIRT030940	hsa-miR-21-5p	Microarray	18591254
MIRT053217	hsa-miR-143-3p	Luciferase reporter assayqRT-PCRWestern blot	23128394
MIRT000306	hsa-miR-145-5p	Luciferase reporter assayqRT-PCRWestern blot	23128394
MIRT000306	hsa-miR-145-5p	qRT-PCRWestern blot	25273883
MIRT000306	hsa-miR-145-5p	qRT-PCRWestern blot	25273883
MIRT445485	hsa-miR-4668-3p	PAR-CLIP	22100165
MIRT445483	hsa-miR-4480	PAR-CLIP	22100165
MIRT445484	hsa-miR-489-3p	PAR-CLIP	22100165
MIRT445485	hsa-miR-4668-3p	PAR-CLIP	22100165
MIRT445483	hsa-miR-4480	PAR-CLIP	22100165
MIRT445484	hsa-miR-489-3p	PAR-CLIP	22100165
MIRT445485	hsa-miR-4668-3p	PAR-CLIP	22100165
MIRT445483	hsa-miR-4480	PAR-CLIP	22100165
MIRT445484	hsa-miR-489-3p	PAR-CLIP	22100165
MIRT445485	hsa-miR-4668-3p	PAR-CLIP	22100165
MIRT445483	hsa-miR-4480	PAR-CLIP	22100165
MIRT445484	hsa-miR-489-3p	PAR-CLIP	22100165
MIRT755350	hsa-miR-375	Luciferase reporter assayWestern blottingqRT-PCRImmunoprecipitaion (IP)	36074222
MIRT755620	hsa-miR-202-5p	qRT-PCR	35795823
MIRT000306	hsa-miR-145-5p	Luciferase reporter assayWestern blottingqRT-PCRImmunohistochemistry (IHC)In situ hybridization	37997376
MIRT756193	hsa-miR-223-3p	Western blottingqRT-PCR	38155264
MIRT1096611	hsa-miR-101	CLIP-seq
MIRT1096612	hsa-miR-1179	CLIP-seq
MIRT1096613	hsa-miR-1183	CLIP-seq
MIRT1096614	hsa-miR-1202	CLIP-seq
MIRT1096615	hsa-miR-1257	CLIP-seq
MIRT1096616	hsa-miR-127-5p	CLIP-seq
MIRT1096617	hsa-miR-1278	CLIP-seq
MIRT1096618	hsa-miR-1282	CLIP-seq
MIRT1096619	hsa-miR-21	CLIP-seq
MIRT1096620	hsa-miR-217	CLIP-seq
MIRT1096621	hsa-miR-219-2-3p	CLIP-seq
MIRT1096622	hsa-miR-2964a-3p	CLIP-seq
MIRT1096623	hsa-miR-3135	CLIP-seq
MIRT1096624	hsa-miR-3149	CLIP-seq
MIRT1096625	hsa-miR-3163	CLIP-seq
MIRT1096626	hsa-miR-3180-5p	CLIP-seq
MIRT1096627	hsa-miR-3545-3p	CLIP-seq
MIRT1096628	hsa-miR-3611	CLIP-seq
MIRT1096629	hsa-miR-3650	CLIP-seq
MIRT1096630	hsa-miR-3662	CLIP-seq
MIRT1096631	hsa-miR-3675-3p	CLIP-seq
MIRT1096632	hsa-miR-3692	CLIP-seq
MIRT1096633	hsa-miR-374a	CLIP-seq
MIRT1096634	hsa-miR-374b	CLIP-seq
MIRT1096635	hsa-miR-374c	CLIP-seq
MIRT755350	hsa-miR-375	CLIP-seq
MIRT1096636	hsa-miR-3938	CLIP-seq
MIRT1096637	hsa-miR-3972	CLIP-seq
MIRT1096638	hsa-miR-4328	CLIP-seq
MIRT1096639	hsa-miR-4418	CLIP-seq
MIRT1096640	hsa-miR-4666-3p	CLIP-seq
MIRT1096641	hsa-miR-4699-3p	CLIP-seq
MIRT1096642	hsa-miR-4709-5p	CLIP-seq
MIRT1096643	hsa-miR-4729	CLIP-seq
MIRT1096644	hsa-miR-4755-3p	CLIP-seq
MIRT1096645	hsa-miR-4760-3p	CLIP-seq
MIRT1096646	hsa-miR-4786-3p	CLIP-seq
MIRT1096647	hsa-miR-500a	CLIP-seq
MIRT1096648	hsa-miR-509-3-5p	CLIP-seq
MIRT1096649	hsa-miR-509-5p	CLIP-seq
MIRT1096650	hsa-miR-520a-5p	CLIP-seq
MIRT1096651	hsa-miR-520d-5p	CLIP-seq
MIRT1096652	hsa-miR-524-5p	CLIP-seq
MIRT1096653	hsa-miR-525-5p	CLIP-seq
MIRT1096654	hsa-miR-532-5p	CLIP-seq
MIRT1096655	hsa-miR-548ac	CLIP-seq
MIRT1096656	hsa-miR-548ae	CLIP-seq
MIRT1096657	hsa-miR-548aj	CLIP-seq
MIRT1096658	hsa-miR-548am	CLIP-seq
MIRT1096659	hsa-miR-548d-3p	CLIP-seq
MIRT1096660	hsa-miR-548x	CLIP-seq
MIRT1096661	hsa-miR-548z	CLIP-seq
MIRT1096662	hsa-miR-590-5p	CLIP-seq
MIRT1096663	hsa-miR-600	CLIP-seq
MIRT1096664	hsa-miR-603	CLIP-seq
MIRT1096665	hsa-miR-630	CLIP-seq
MIRT1096666	hsa-miR-655	CLIP-seq
MIRT1096667	hsa-miR-670	CLIP-seq
MIRT1096668	hsa-miR-758	CLIP-seq
MIRT1096669	hsa-miR-9	CLIP-seq
MIRT1096670	hsa-miR-944	CLIP-seq
MIRT1096611	hsa-miR-101	CLIP-seq
MIRT1096617	hsa-miR-1278	CLIP-seq
MIRT1096618	hsa-miR-1282	CLIP-seq
MIRT1096620	hsa-miR-217	CLIP-seq
MIRT2026120	hsa-miR-23a	CLIP-seq
MIRT2026121	hsa-miR-23b	CLIP-seq
MIRT2026122	hsa-miR-23c	CLIP-seq
MIRT1096623	hsa-miR-3135	CLIP-seq
MIRT1096626	hsa-miR-3180-5p	CLIP-seq
MIRT2026123	hsa-miR-3182	CLIP-seq
MIRT2026124	hsa-miR-339-5p	CLIP-seq
MIRT2026125	hsa-miR-3646	CLIP-seq
MIRT2026126	hsa-miR-3658	CLIP-seq
MIRT1096630	hsa-miR-3662	CLIP-seq
MIRT2026127	hsa-miR-3671	CLIP-seq
MIRT2026128	hsa-miR-371-5p	CLIP-seq
MIRT2026129	hsa-miR-371b-5p	CLIP-seq
MIRT1096635	hsa-miR-374c	CLIP-seq
MIRT1096636	hsa-miR-3938	CLIP-seq
MIRT2026130	hsa-miR-4299	CLIP-seq
MIRT1096639	hsa-miR-4418	CLIP-seq
MIRT2026131	hsa-miR-4456	CLIP-seq
MIRT2026132	hsa-miR-4659a-3p	CLIP-seq
MIRT2026133	hsa-miR-4659b-3p	CLIP-seq
MIRT1096640	hsa-miR-4666-3p	CLIP-seq
MIRT1096641	hsa-miR-4699-3p	CLIP-seq
MIRT1096642	hsa-miR-4709-5p	CLIP-seq
MIRT2026134	hsa-miR-4711-5p	CLIP-seq
MIRT2026135	hsa-miR-4722-3p	CLIP-seq
MIRT2026136	hsa-miR-4763-5p	CLIP-seq
MIRT2026137	hsa-miR-4778-3p	CLIP-seq
MIRT1096648	hsa-miR-509-3-5p	CLIP-seq
MIRT1096649	hsa-miR-509-5p	CLIP-seq
MIRT2026138	hsa-miR-513c	CLIP-seq
MIRT2026139	hsa-miR-514b-5p	CLIP-seq
MIRT2026140	hsa-miR-548q	CLIP-seq
MIRT2026141	hsa-miR-550a	CLIP-seq
MIRT1096665	hsa-miR-630	CLIP-seq
MIRT1096666	hsa-miR-655	CLIP-seq
MIRT1096667	hsa-miR-670	CLIP-seq
MIRT1096611	hsa-miR-101	CLIP-seq
MIRT1096612	hsa-miR-1179	CLIP-seq
MIRT2257201	hsa-miR-1273f	CLIP-seq
MIRT1096616	hsa-miR-127-5p	CLIP-seq
MIRT1096617	hsa-miR-1278	CLIP-seq
MIRT1096618	hsa-miR-1282	CLIP-seq
MIRT2257202	hsa-miR-1305	CLIP-seq
MIRT2257203	hsa-miR-143	CLIP-seq
MIRT2257204	hsa-miR-186	CLIP-seq
MIRT2257205	hsa-miR-1913	CLIP-seq
MIRT2257206	hsa-miR-2115	CLIP-seq
MIRT1096620	hsa-miR-217	CLIP-seq
MIRT2026120	hsa-miR-23a	CLIP-seq
MIRT2026121	hsa-miR-23b	CLIP-seq
MIRT2026122	hsa-miR-23c	CLIP-seq
MIRT2257207	hsa-miR-3120-3p	CLIP-seq
MIRT2257208	hsa-miR-3133	CLIP-seq
MIRT1096623	hsa-miR-3135	CLIP-seq
MIRT2257209	hsa-miR-3140-3p	CLIP-seq
MIRT1096626	hsa-miR-3180-5p	CLIP-seq
MIRT2257210	hsa-miR-323-3p	CLIP-seq
MIRT2257211	hsa-miR-324-3p	CLIP-seq
MIRT1096630	hsa-miR-3662	CLIP-seq
MIRT2257212	hsa-miR-3667-3p	CLIP-seq
MIRT1096635	hsa-miR-374c	CLIP-seq
MIRT2257213	hsa-miR-3977	CLIP-seq
MIRT2257214	hsa-miR-421	CLIP-seq
MIRT2257215	hsa-miR-4310	CLIP-seq
MIRT1096638	hsa-miR-4328	CLIP-seq
MIRT1096639	hsa-miR-4418	CLIP-seq
MIRT2257216	hsa-miR-4509	CLIP-seq
MIRT1096640	hsa-miR-4666-3p	CLIP-seq
MIRT1096641	hsa-miR-4699-3p	CLIP-seq
MIRT2257217	hsa-miR-4708-5p	CLIP-seq
MIRT1096642	hsa-miR-4709-5p	CLIP-seq
MIRT2026134	hsa-miR-4711-5p	CLIP-seq
MIRT2257218	hsa-miR-4716-5p	CLIP-seq
MIRT2257219	hsa-miR-4727-5p	CLIP-seq
MIRT1096643	hsa-miR-4729	CLIP-seq
MIRT2257220	hsa-miR-4744	CLIP-seq
MIRT2257221	hsa-miR-4770	CLIP-seq
MIRT2257222	hsa-miR-4778-5p	CLIP-seq
MIRT1096646	hsa-miR-4786-3p	CLIP-seq
MIRT1096648	hsa-miR-509-3-5p	CLIP-seq
MIRT1096649	hsa-miR-509-5p	CLIP-seq
MIRT2257223	hsa-miR-516a-3p	CLIP-seq
MIRT1096650	hsa-miR-520a-5p	CLIP-seq
MIRT1096651	hsa-miR-520d-5p	CLIP-seq
MIRT1096652	hsa-miR-524-5p	CLIP-seq
MIRT1096653	hsa-miR-525-5p	CLIP-seq
MIRT1096655	hsa-miR-548ac	CLIP-seq
MIRT1096656	hsa-miR-548ae	CLIP-seq
MIRT1096657	hsa-miR-548aj	CLIP-seq
MIRT1096658	hsa-miR-548am	CLIP-seq
MIRT1096659	hsa-miR-548d-3p	CLIP-seq
MIRT1096660	hsa-miR-548x	CLIP-seq
MIRT1096661	hsa-miR-548z	CLIP-seq
MIRT1096663	hsa-miR-600	CLIP-seq
MIRT1096664	hsa-miR-603	CLIP-seq
MIRT2257224	hsa-miR-604	CLIP-seq
MIRT2257225	hsa-miR-616	CLIP-seq
MIRT2257226	hsa-miR-642a	CLIP-seq
MIRT2257227	hsa-miR-647	CLIP-seq
MIRT1096666	hsa-miR-655	CLIP-seq
MIRT2257228	hsa-miR-659	CLIP-seq
MIRT2257229	hsa-miR-660	CLIP-seq
MIRT1096669	hsa-miR-9	CLIP-seq
MIRT2257230	hsa-miR-938	CLIP-seq
MIRT1096670	hsa-miR-944	CLIP-seq
MIRT2430464	hsa-miR-145	CLIP-seq
MIRT2430465	hsa-miR-300	CLIP-seq
MIRT1096626	hsa-miR-3180-5p	CLIP-seq
MIRT2026127	hsa-miR-3671	CLIP-seq
MIRT2430466	hsa-miR-381	CLIP-seq
MIRT1096640	hsa-miR-4666-3p	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
AR	Unknown	19460858
SMURF2	Repression	21953463

Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	16595680
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	16595680
GO:0001525	Process	Angiogenesis	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	17320083, 32814053, 35140242
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0014816	Process	Skeletal muscle satellite cell differentiation	IEA
GO:0014901	Process	Satellite cell activation involved in skeletal muscle regeneration	IEA
GO:0014908	Process	Myotube differentiation involved in skeletal muscle regeneration	IEA
GO:0030033	Process	Microvillus assembly	IEA
GO:0032534	Process	Regulation of microvillus assembly	IEA
GO:0035914	Process	Skeletal muscle cell differentiation	IEA
GO:0043403	Process	Skeletal muscle tissue regeneration	IEA
GO:0043426	Function	MRF binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16595680
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0060576	Process	Intestinal epithelial cell development	IEA
GO:0061586	Process	Positive regulation of transcription by transcription factor localization	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA
GO:1990859	Process	Cellular response to endothelin	IEA

MIM	HGNC	e!Ensembl
602903	6349	ENSG00000102554

Q13887

Protein name

Krueppel-like factor 5 (Basic transcription element-binding protein 2) (BTE-binding protein 2) (Colon krueppel-like factor) (GC-box-binding protein 2) (Intestinal-enriched krueppel-like factor) (Transcription factor BTEB2)

Protein function

Transcription factor that binds to GC box promoter elements. Activates the transcription of these genes.

PDB

2EBT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	373 → 397	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	403 → 427	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	433 → 455	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed only in testis and placenta.

Sequence

MATRVLSMSARLGPVPQPPAPQDEPVFAQLKPVLGAANPARDAALFPGEELKHAHHRPQA
QPAPAQAPQPAQPPATGPRLPPEDLVQTRCEMEKYLTPQLPPVPIIPEHKKYRRDSASVV
DQFFTDTEGLPYSINMNVFLPDITHLRTGLYKSQRPCVTHIKTEPVAIFSHQSETTAPPP
APTQALPEFTSIFSSHQTAAPEVNNIFIKQELPTPDLHLSVPTQQGHLYQLLNTPDLDMP
SSTNQTAAMDTLNVSMSAAMAGLNTHTSAVPQTAVKQFQGMPPCTYTMPSQFLPQQATYF
PPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTLPVNSQNIQPVRYN
RRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDEL
TRHYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN

Sequence length

457

Interactions

View interactions

	KEGG
	Chemical carcinogenesis - receptor activation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Dilated cardiomyopathy 1FF	Pathogenic	rs2044646731	RCV001078146	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (20)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED, 1FF	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL ADENOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATOCONUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (168)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	31401336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	30510241, 31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	27158780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29896983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	26621868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	GWASCAT_DG	30510241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	LHGDN	14587307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	21566082, 26097551		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26769127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	38433576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	28912007	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	28115390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	20086047, 26992033, 30551500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	20086047, 26992033, 30551500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	26992033	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	31401336, 31632504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	32880368	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	40366121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	12901861, 16184550, 25170806, 26544730, 26786295, 27514407, 28109084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	12901861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	27514407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12242654, 16638850, 19569049, 19668233, 20484041, 21566082, 22936544, 26079537, 26189798, 26419610, 30101462, 30389133, 31073122, 31624151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19411256, 19569049, 21674249, 23913682, 26079537, 26419610, 27117709, 31360115, 31467112, 35022570, 35342356, 37063424, 37997376	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21542805, 31640084	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16223724, 16357509, 16595680, 18774944, 19671674, 20388706, 21542805, 23913682, 23975368, 24401325, 30770877, 31467112, 33827480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	23975368, 26097551, 27940107, 30101462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26176896, 31599412, 32965165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	21674249	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	12901861, 16184550, 25170806, 26544730, 26786295, 27514407, 28109084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	23975368, 31115014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20639455, 24401325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26769127	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	39215019	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34272396, 39948701	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23869764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	19448973, 20086047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	26792671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	29562638		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25119587, 29146991, 29157672, 30131089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	25119587, 29146991, 29157672, 30131089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis	Cholangitis	BEFREE	29523685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	29523685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	33923166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30639269		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	CTD_human_DG	30639269		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	BEFREE	25772234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24398687, 25037223, 29312609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	17164780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21885866, 24398687, 24626089, 30478887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	30510241, 31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	30510241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17430902, 19240162, 19671674, 23880760, 24398687, 25037223, 25683913, 30478887, 32279400, 34707247, 35283273	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18054006		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	30510241, 31089142		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	30510241		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28749461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	11076828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	11076828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	37268267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	11076828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Adenomatoid Malformation of Lung, Congenital	Congenital Cystic Adenomatoid Malformation Of Lung	BEFREE	29896983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	25772234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30271790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	18670098, 28711598, 30271790, 37268267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30271790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	30271790	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17688680, 31049798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	34735495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	27135401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	16357509, 33529461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	22990386	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	22990386, 33789967	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	38087142	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	31409603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	30685841, 31235682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	23372710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	19430298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29375300, 30963560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	19411256, 19569049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	31049798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	BEFREE	16912082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	20086047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19671674, 29898734	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	29196238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	21885866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal Polyposis	BEFREE	29736317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	30201338, 30322616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	23975368, 31115014, 32271410	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24584857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	24584857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	21470678, 21993314, 31452816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	26097551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26176896, 29658584, 30206974, 30473218, 30675287, 31286509, 31599412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	32279400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	26782003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	20639455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24401325, 35154481	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37181807	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	31178864	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	31178864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23975368	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	38087142	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12242654, 16638850, 19569049, 19668233, 20484041, 21566082, 22936544, 26079537, 26189798, 26419610, 30101462, 30389133, 31073122, 31360115, 31624151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	27135401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	30510241, 31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	23975368, 31115014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20639455, 24401325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23869764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19671674, 24041470, 31327760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	26098869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12661032, 16267836, 18774944, 23755247, 25425963, 25896712, 26480897, 28789420, 31002531, 31534497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24078401, 25053715, 30112020, 30367481, 30851060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	30226614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	12901861, 16184550, 25170806, 26544730, 26786295, 27514407, 28109084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	27514407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15087132, 19448973, 19671674, 20639455, 21487105, 24323942, 24626089, 25051115, 25170806, 26176896, 26189798, 26397390, 26474386, 26480897, 26544730 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	21868761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25119587, 29146991, 29157672, 30131089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	24398687, 25037223, 29312609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	30510241, 31089142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12242654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	37268267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	26097551, 38147910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	18570662, 35836107	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11134343, 12242654, 12661032, 16638850, 19654315, 19668233, 19671674, 20484041, 21487105, 21542805, 21993314, 25051115, 25425963, 26480897, 28030791 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25051115, 29773900, 29898734, 30900384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	19569049, 21542805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	35723551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29916536, 30773645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	36272150	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	23869764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23869764, 37702443	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19671674, 24041470, 31327760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	26098869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19671674	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24041470, 25409614, 31327760, 31917448, 31997706, 38433576	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Periodontitis	Periodontitis	Pubtator	35249460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	30038712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12661032, 16267836, 18774944, 23755247, 25425963, 25896712, 26480897, 28789420, 31002531, 31534497		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12661032, 18774944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18774944, 19460858, 32281273, 34737261, 38052806	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	25425963, 25896712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31257528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	31257528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26792671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	31388510, 31508397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	32093658	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18226501		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	18226501		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	18226501		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMITH-MCCORT DYSPLASIA 1	Smith-McCort Dysplasia	BEFREE	27624660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21868761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	27158780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23633919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23975368, 26474386, 35398964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24078401, 25053715, 30112020, 30367481, 30851060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30685841, 30770877, 31235682, 32373958, 33923166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	25504335, 26782003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	30226614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	30226614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28030791, 28437471, 28480051, 28740556, 29348684, 29407962, 29760406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28030791, 28437471, 32025209, 36042208, 36509121, 36633714	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	26786295, 27514407, 28109084	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Dysplasia	Uterine disease	Pubtator	31235682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25119587	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	30018982, 30131089, 33827480, 34233586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	26782003		★★★★★ ★☆☆☆☆ Found in Text Mining only

KLF5 (KLF transcription factor 5)