Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6879
Gene name	TATA-box binding protein associated factor 7
Gene symbol	TAF7
Synonyms (NCBI Gene)	TAF2FTAFII55
Chromosome	5
Chromosome location	5q31.3
Summary	The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box i

159

Show/Hide all (159)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016037	hsa-miR-374b-5p	Sequencing	20371350
MIRT563943	hsa-miR-6507-3p	PAR-CLIP	20371350
MIRT563941	hsa-miR-4694-3p	PAR-CLIP	20371350
MIRT563942	hsa-miR-6838-3p	PAR-CLIP	20371350
MIRT563940	hsa-miR-545-5p	PAR-CLIP	20371350
MIRT563939	hsa-miR-6508-5p	PAR-CLIP	20371350
MIRT563938	hsa-miR-8067	PAR-CLIP	20371350
MIRT563937	hsa-miR-4434	PAR-CLIP	20371350
MIRT563936	hsa-miR-4516	PAR-CLIP	20371350
MIRT563935	hsa-miR-5703	PAR-CLIP	20371350
MIRT121732	hsa-miR-518d-5p	PAR-CLIP	20371350
MIRT121731	hsa-miR-518e-5p	PAR-CLIP	20371350
MIRT121728	hsa-miR-518f-5p	PAR-CLIP	20371350
MIRT121734	hsa-miR-519a-5p	PAR-CLIP	20371350
MIRT121726	hsa-miR-519b-5p	PAR-CLIP	20371350
MIRT121725	hsa-miR-519c-5p	PAR-CLIP	20371350
MIRT121730	hsa-miR-520c-5p	PAR-CLIP	20371350
MIRT121733	hsa-miR-522-5p	PAR-CLIP	20371350
MIRT121727	hsa-miR-523-5p	PAR-CLIP	20371350
MIRT121729	hsa-miR-526a	PAR-CLIP	20371350
MIRT563934	hsa-miR-4777-5p	PAR-CLIP	20371350
MIRT563933	hsa-miR-4531	PAR-CLIP	20371350
MIRT563943	hsa-miR-6507-3p	PAR-CLIP	20371350
MIRT563941	hsa-miR-4694-3p	PAR-CLIP	20371350
MIRT563942	hsa-miR-6838-3p	PAR-CLIP	20371350
MIRT563940	hsa-miR-545-5p	PAR-CLIP	20371350
MIRT563939	hsa-miR-6508-5p	PAR-CLIP	20371350
MIRT563938	hsa-miR-8067	PAR-CLIP	20371350
MIRT563937	hsa-miR-4434	PAR-CLIP	20371350
MIRT563936	hsa-miR-4516	PAR-CLIP	20371350
MIRT563935	hsa-miR-5703	PAR-CLIP	20371350
MIRT121732	hsa-miR-518d-5p	PAR-CLIP	20371350
MIRT121731	hsa-miR-518e-5p	PAR-CLIP	20371350
MIRT121728	hsa-miR-518f-5p	PAR-CLIP	20371350
MIRT121734	hsa-miR-519a-5p	PAR-CLIP	20371350
MIRT121726	hsa-miR-519b-5p	PAR-CLIP	20371350
MIRT121725	hsa-miR-519c-5p	PAR-CLIP	20371350
MIRT121730	hsa-miR-520c-5p	PAR-CLIP	20371350
MIRT121733	hsa-miR-522-5p	PAR-CLIP	20371350
MIRT121727	hsa-miR-523-5p	PAR-CLIP	20371350
MIRT121729	hsa-miR-526a	PAR-CLIP	20371350
MIRT563934	hsa-miR-4777-5p	PAR-CLIP	20371350
MIRT563933	hsa-miR-4531	PAR-CLIP	20371350
MIRT1409737	hsa-miR-1284	CLIP-seq
MIRT1409738	hsa-miR-155	CLIP-seq
MIRT1409739	hsa-miR-181a	CLIP-seq
MIRT1409740	hsa-miR-181b	CLIP-seq
MIRT1409741	hsa-miR-181c	CLIP-seq
MIRT1409742	hsa-miR-181d	CLIP-seq
MIRT1409743	hsa-miR-1912	CLIP-seq
MIRT1409744	hsa-miR-300	CLIP-seq
MIRT1409745	hsa-miR-3124-3p	CLIP-seq
MIRT1409746	hsa-miR-3130-5p	CLIP-seq
MIRT1409747	hsa-miR-3133	CLIP-seq
MIRT1409748	hsa-miR-338-5p	CLIP-seq
MIRT1409749	hsa-miR-3685	CLIP-seq
MIRT1409750	hsa-miR-374c	CLIP-seq
MIRT1409751	hsa-miR-381	CLIP-seq
MIRT1409752	hsa-miR-384	CLIP-seq
MIRT1409753	hsa-miR-4262	CLIP-seq
MIRT1409754	hsa-miR-4263	CLIP-seq
MIRT1409755	hsa-miR-4310	CLIP-seq
MIRT1409756	hsa-miR-4476	CLIP-seq
MIRT1409757	hsa-miR-4482	CLIP-seq
MIRT1409758	hsa-miR-4511	CLIP-seq
MIRT1409759	hsa-miR-4666-3p	CLIP-seq
MIRT1409760	hsa-miR-4712-5p	CLIP-seq
MIRT1409761	hsa-miR-4727-5p	CLIP-seq
MIRT1409762	hsa-miR-4728-3p	CLIP-seq
MIRT1409763	hsa-miR-4759	CLIP-seq
MIRT1409764	hsa-miR-4772-3p	CLIP-seq
MIRT1409765	hsa-miR-500a	CLIP-seq
MIRT1409766	hsa-miR-544	CLIP-seq
MIRT1409767	hsa-miR-572	CLIP-seq
MIRT1409768	hsa-miR-576-5p	CLIP-seq
MIRT1409769	hsa-miR-622	CLIP-seq
MIRT1409770	hsa-miR-628-5p	CLIP-seq
MIRT1409771	hsa-miR-646	CLIP-seq
MIRT1409772	hsa-miR-655	CLIP-seq
MIRT1409773	hsa-miR-770-5p	CLIP-seq
MIRT1409774	hsa-miR-891b	CLIP-seq
MIRT2122792	hsa-miR-1265	CLIP-seq
MIRT1409737	hsa-miR-1284	CLIP-seq
MIRT1409739	hsa-miR-181a	CLIP-seq
MIRT1409740	hsa-miR-181b	CLIP-seq
MIRT1409741	hsa-miR-181c	CLIP-seq
MIRT1409742	hsa-miR-181d	CLIP-seq
MIRT2122793	hsa-miR-2392	CLIP-seq
MIRT1409744	hsa-miR-300	CLIP-seq
MIRT1409745	hsa-miR-3124-3p	CLIP-seq
MIRT2122794	hsa-miR-3153	CLIP-seq
MIRT1409748	hsa-miR-338-5p	CLIP-seq
MIRT1409749	hsa-miR-3685	CLIP-seq
MIRT2122795	hsa-miR-370	CLIP-seq
MIRT1409751	hsa-miR-381	CLIP-seq
MIRT1409752	hsa-miR-384	CLIP-seq
MIRT1409753	hsa-miR-4262	CLIP-seq
MIRT2122796	hsa-miR-4646-5p	CLIP-seq
MIRT1409759	hsa-miR-4666-3p	CLIP-seq
MIRT2122797	hsa-miR-4668-5p	CLIP-seq
MIRT1409761	hsa-miR-4727-5p	CLIP-seq
MIRT1409764	hsa-miR-4772-3p	CLIP-seq
MIRT1409765	hsa-miR-500a	CLIP-seq
MIRT1409766	hsa-miR-544	CLIP-seq
MIRT2122798	hsa-miR-548p	CLIP-seq
MIRT2122799	hsa-miR-570	CLIP-seq
MIRT1409767	hsa-miR-572	CLIP-seq
MIRT2122800	hsa-miR-582-3p	CLIP-seq
MIRT1409774	hsa-miR-891b	CLIP-seq
MIRT1409737	hsa-miR-1284	CLIP-seq
MIRT1409739	hsa-miR-181a	CLIP-seq
MIRT1409740	hsa-miR-181b	CLIP-seq
MIRT1409741	hsa-miR-181c	CLIP-seq
MIRT1409742	hsa-miR-181d	CLIP-seq
MIRT1409744	hsa-miR-300	CLIP-seq
MIRT1409745	hsa-miR-3124-3p	CLIP-seq
MIRT1409748	hsa-miR-338-5p	CLIP-seq
MIRT1409749	hsa-miR-3685	CLIP-seq
MIRT2122795	hsa-miR-370	CLIP-seq
MIRT1409750	hsa-miR-374c	CLIP-seq
MIRT1409751	hsa-miR-381	CLIP-seq
MIRT1409752	hsa-miR-384	CLIP-seq
MIRT1409753	hsa-miR-4262	CLIP-seq
MIRT1409759	hsa-miR-4666-3p	CLIP-seq
MIRT1409761	hsa-miR-4727-5p	CLIP-seq
MIRT1409764	hsa-miR-4772-3p	CLIP-seq
MIRT1409765	hsa-miR-500a	CLIP-seq
MIRT1409766	hsa-miR-544	CLIP-seq
MIRT2122798	hsa-miR-548p	CLIP-seq
MIRT1409767	hsa-miR-572	CLIP-seq
MIRT1409772	hsa-miR-655	CLIP-seq
MIRT1409774	hsa-miR-891b	CLIP-seq
MIRT2461094	hsa-miR-15a	CLIP-seq
MIRT2461095	hsa-miR-15b	CLIP-seq
MIRT2461096	hsa-miR-16	CLIP-seq
MIRT2461097	hsa-miR-195	CLIP-seq
MIRT2461098	hsa-miR-330-3p	CLIP-seq
MIRT2461099	hsa-miR-424	CLIP-seq
MIRT2461100	hsa-miR-4719	CLIP-seq
MIRT2461101	hsa-miR-497	CLIP-seq
MIRT1409771	hsa-miR-646	CLIP-seq
MIRT2461094	hsa-miR-15a	CLIP-seq
MIRT2461095	hsa-miR-15b	CLIP-seq
MIRT2461096	hsa-miR-16	CLIP-seq
MIRT2461097	hsa-miR-195	CLIP-seq
MIRT2461098	hsa-miR-330-3p	CLIP-seq
MIRT2461099	hsa-miR-424	CLIP-seq
MIRT2461100	hsa-miR-4719	CLIP-seq
MIRT2461101	hsa-miR-497	CLIP-seq
MIRT1409771	hsa-miR-646	CLIP-seq
MIRT2461094	hsa-miR-15a	CLIP-seq
MIRT2461095	hsa-miR-15b	CLIP-seq
MIRT2461096	hsa-miR-16	CLIP-seq
MIRT2461097	hsa-miR-195	CLIP-seq
MIRT2461098	hsa-miR-330-3p	CLIP-seq
MIRT2461099	hsa-miR-424	CLIP-seq
MIRT2461100	hsa-miR-4719	CLIP-seq
MIRT2461101	hsa-miR-497	CLIP-seq
MIRT1409771	hsa-miR-646	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
SP1	Activation	12364593
SP1	Unknown	11340078
TFAP2A	Activation	12364593

Show/Hide all (54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	16407123
GO:0000296	Process	Spermine transport	ISS
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	18391197
GO:0001097	Function	TFIIH-class transcription factor complex binding	IDA	18391197
GO:0001673	Component	Male germ cell nucleus	IEA
GO:0005515	Function	Protein binding	IPI	7824954, 16407123, 32814053
GO:0005634	Component	Nucleus	EXP	23332750
GO:0005634	Component	Nucleus	IDA	29203640
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IPI	25412659
GO:0005669	Component	Transcription factor TFIID complex	IBA
GO:0005669	Component	Transcription factor TFIID complex	IDA	7824954, 14580349, 24927529, 25412659, 27007846, 29111974
GO:0005669	Component	Transcription factor TFIID complex	IEA
GO:0005669	Component	Transcription factor TFIID complex	IPI	23332750
GO:0005669	Component	Transcription factor TFIID complex	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0006282	Process	Regulation of DNA repair	NAS	11406595
GO:0006325	Process	Chromatin organization	IEA
GO:0006352	Process	DNA-templated transcription initiation	IDA	9603525
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	9603525
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IDA	7824954, 11592977, 18391197
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	IDA	9603525, 16407123
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	IEA
GO:0006469	Process	Negative regulation of protein kinase activity	IDA	18391197
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IBA
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IDA	9603525
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IDA	7824954, 25412659
GO:0030520	Process	Estrogen receptor signaling pathway	IEA
GO:0033276	Component	Transcription factor TFTC complex	IDA	9603525
GO:0033276	Component	Transcription factor TFTC complex	NAS	10373431
GO:0035035	Function	Histone acetyltransferase binding	IEA
GO:0035035	Function	Histone acetyltransferase binding	IPI	11592977
GO:0042789	Process	MRNA transcription by RNA polymerase II	IDA	17884155
GO:0042809	Function	Nuclear vitamin D receptor binding	IPI	10409738
GO:0045344	Process	Negative regulation of MHC class I biosynthetic process	IDA	20937824
GO:0045347	Process	Negative regulation of MHC class II biosynthetic process	IMP	20937824
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	11592977, 16407123, 18391197
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	18206972
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12676957, 17884155
GO:0046966	Function	Nuclear thyroid hormone receptor binding	IPI	10409738
GO:0046982	Function	Protein heterodimerization activity	IPI	25412659
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	IBA
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	IPI	27007846
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	ISS
GO:0060261	Process	Positive regulation of transcription initiation by RNA polymerase II	IDA	17884155
GO:0061628	Function	Histone H3K27me3 reader activity	IPI	24927529
GO:0071339	Component	MLL1 complex	IDA	15960975
GO:0106140	Function	P-TEFb complex binding	IDA	18391197
GO:0140297	Function	DNA-binding transcription factor binding	IPI	7824954, 11005381, 12676957

MIM	HGNC	e!Ensembl
600573	11541	ENSG00000178913

Q15545

Protein name

Transcription initiation factor TFIID subunit 7 (RNA polymerase II TBP-associated factor subunit F) (Transcription initiation factor TFIID 55 kDa subunit) (TAF(II)55) (TAFII-55) (TAFII55)

Protein function

The TFIID basal transcription factor complex plays a major role in the initiation of RNA polymerase II (Pol II)-dependent transcription (PubMed:33795473). TFIID recognizes and binds promoters with or without a TATA box via its subunit TBP, a TAT

PDB

4RGW , 5FUR , 6MZL , 6MZM , 7EDX , 7EG7 , 7EG8 , 7EG9 , 7EGA , 7EGB , 7EGC , 7EGD , 7EGE , 7EGH , 7EGI , 7EGJ , 7ENA , 7ENC , 8GXQ , 8GXS , 8WAK , 8WAL , 8WAN , 8WAO , 8WAP , 8WAQ , 8WAR , 8WAS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04658	TAFII55_N	12 → 177	TAFII55 protein conserved region	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDR
VPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASK
KKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTR
WEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQD
EEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAK
RQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK

Sequence length

349

Interactions

View interactions

	KEGG		Reactome
	Basal transcription factors		RNA Polymerase II Pre-transcription Events Regulation of TP53 Activity through Phosphorylation RNA Polymerase II Promoter Escape RNA Polymerase II Transcription Pre-Initiation And Promoter Opening RNA Polymerase II Transcription Initiation RNA Polymerase II Transcription Initiation And Promoter Clearance

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Azoospermia	Azoospermia	Pubtator	34762273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31162714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31162714	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	Pubtator	29409727	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	34762273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31162714		★★★★★ ★☆☆☆☆ Found in Text Mining only

TAF7 (TATA-box binding protein associated factor 7)